Welcome to Talk Amongst Yourselves, AKA ‘TAY’. Organise meet-ups, talk about games, talk about anything you want! Consider this the unofficial Kotaku Australia forum. Become a TAYbie today and join the best and friendliest community on the internet!
See Games Differently
Now you can get the top stories from Kotaku delivered to your inbox. Enter your email below.
By subscribing you agree to our Terms of Use and Privacy Policy.
Comments
1,655 responses to “Talk Amongst Yourselves”
PREVIOUSLY, ON GENERAL HOSPI-TAY-L
~
Freyjr is rushing through the emergency ward.
Frejyr: Everyone, this ward has been placed under quarantine! Nobody will be allowed to leave until we have verified that it is safe.
Pants: But…my quinceañera…
Freya: Nuts to your quinceañera!
~
Freeze and Nobs have sequestered themselves in an empty hospital room.
Nobs: We…might not make it out of here, Freeze. I just wanted to say –
Freeze: Don’t say anything, Nobs.
Nobs: But I –
A finger is held to his lips as the two lock eyes why the hell am I writing this.
~
In a darkened room, Strange secrets a knife from a nearby uneaten meal.
Strange: I’m getting out of here tonight if it’s the last thing I do…
~
Everyone sits around looking super bored.
Red: What are we going to do to pass the time?
Trjn descends from the ceiling.
Trjn: Did someone say BOARD GAMES?
He opens his magical bag of holding. An endless cascade of board games burst out from within. Several people are crushed against the back wall from their forceful ejection.
Trjn sips tea.
~
Rize plays an IV drip in a cafeteria jazz ensemble.
~
A hysterical Cakesmith runs rampant around the ward, screaming.
Cakesmith: LET ME OUT LET ME OUT LET ME OUT LET ME OUT (and so on)
He attempts to open one of the sealed doors. Freya points a finger.
Freyjr: Restrain him! He can’t be allowed to leave!
Cut to Cakesmith tied to a radiator, sobbing.
~
Meanwhile, at their home, Beavwa and Pip have adopted a cute puppy. Everything is sunshine and rainbows.
Pip: I wonder how everyone else is doing.
~
A throng of TAYbies circle the cafeteria staff, makeshift weapons in hand.
Powalen: Hand over the food!
For some reason Greenius is standing with the staff.
Greenius: No! It’s all mine!
He begins eating everything in sight. The mob rushes him.
~
Nurse Transient paces back and forth, worried.
Transient: We need to operate but we’re hideously understaffed oh what will we ever do.
???: Maybe…I can help.
Pixel steps out from the shadows.
Transient: Do you have any experience operating?
Pixel: I’ve played Surgeon Simulator.
Transient: Perfect.
Smash cut to Pixel performing surgery, tearing bone and organs from a man’s chest with a pizza cutter.
Transient: We’re meant to be operating on his leg!
Pixel: HAHAHAHAHA! WAHAHAHAHAHAHA!
~
Freyjr studies a report, her brow furrowing further with each line.
Freya: My god…
She looks directly into the camera.
Frejyr: None of us are leaving here alive.
~
AND NOW, THE THRILLING CONTINUATION
I hope someone is collating all of these for a leather-bound tome to be produced at its conclusion.
I love the surgeon simulator one. They didn’t cover legs in the game!
I choose to read this as a threat.
She’s a fighty drunk.
She’ll also try to push you out of a moving taxi when sober.
HAHAHAHAHA! WAHAHAHAHAHAHA!
I swear @rize can jazz anything. The man is a maestro.
Accidentally replied to you Pixel, my bad. But still, SOMEONE STOP THIS CRAZY MAN!
I am so juzz.
“I’m about to make the first incision”
*Raises axe*
Wait, am I at the hospital too?
I can’t see this ending well.
Only pip and beavwa are not in the hospital as fair as I can tell.
Splatoon’s maps keep getting better and better, and it’s becoming obvious that they’re being released on a difficulty curve. Camp triggerfish is particularly great in splat zones!
Also, that new ad showing off the splatling gun and paint bucket is pretty rad:
https://youtu.be/WmXtjm7rSsg
So, that’s how I spent my weekend, collecting hats.
I find that I often Main the 52. Gal. It took me 3 goes on camp triggerfish before I was able to get it. There is supposed to be a good update in August dropping.
One of the directors hinted that we’d see things like the ink rails make it into multiplayer. That’s going to be pretty epic.
The August update will let team ranked battles happen, which will be when splatoon turns into serious bismuth. I was playing games full of my friends list yesterday, we were all on voice chat and it was stupid fun. Private matches would make it way better though.
I always get stuck on the opposite team of my friends D=
With seven friends online in the same game that is never a problem! :p
Most I’ve had is 3 (including me) and for some reason, I am almost always on the other team.
So I decided to test out Rocket League and I immediately became addicted. I was having so much fun I didn’t set up my recording equipment properly.
I made a playlist https://www.youtube.com/playlist?list=PLXCMHjsKWdPFETZHO-rqGO3h07r_bWGoj
Nice!
Morning errbody hows every little thing? My weekend had Highs and Lows and those Highs and Lows had Highs and Lows so let the ramblings begin!
Friday: Friday I had a Job interview, I thinkit went well otherwise the lady was patronizing me and in which case boo, either way I was invited to their careers night on tuesday and now I have to decide if I want to suit it or not decisions decisions. Also on Friday I had no work which is terrible for my paycheck but I got to play vidya games which is good for other things. I platinumed Rocket League as well as hit Pro rank level 20 so we went out to dinner at Captain Americas Hamburger Heaven, it was delicious and stupidely filling. When we got home Cathryn was tired so she went to bed and I stayed up watching Blue Exorcist not a bad anime.
Saturday: I slept till 11:30, then we took the dogs for a walk to the dog park so they could meet new people and just generally have fun, after that we went to the shops and had Schnitz for lunch, it was alright. Also I brought a new wallet, and a doggy tshirt for moni. I cooked fajitas for dinner which was delicious and cathryn and I stayed up watching Shameless and Upper Middle Bogan, not bad shows.
Sunday: It was on off raining and we didn’t get uptil 10:30, the dogs were sleepy so didnt take them for a walk. I made Cathryn bacon and eggs for brekkie, we had hot dogs for lunch, I got my phone screen fixed AND I started lego jurassic park. That night was the low part of the weekend, shadow whos blind fell in the pool and moni burst into the house starts agressive barking at mum, mum goes outside sees shadow freaking out in the deep end of the pool moni by this point was beside him tryna bite his collar to keep him above water, mums sprinted for him and because it was wet has fallen down the stairs and cut her arm open, got up and grabbed shadow as I’ve ran outside with a towel to dry him and the entire time moni didnt leave his side when he was out of the water to make sure he was ok.
I have no monday morning question.
Career night? Formal casual! Shirt, dress pants, and a tie! (shoes are optional)
Hectic man. Scary shit with dark and pool and stuff.
Long day Saturday, helped a friend move into a unit at Hornsby which is a million times better than our current place and a mere 90% more rent than we’re currently paying, which has started my wife talking about us moving again. I think she really means it this time, so we’re going to start pinching pennies to save a deposit and see what kind of rent we can really afford. I was hoping to not move until I’d been promoted and paying the rent was easy, but I also expected to be promoted sometime this year which seems less and less likely especially with the company being bought out. Maybe next year, maybe I’ll be lucky just to not be made redundant. Who knows.
My boss is back today after a month of annual leave. The team racked our brains for pranks on Friday and came up blank. The trials of being an adult I guess, we were genuinely concerned that the undoing of the prank would result in a loss of productivity. Like everyone just unilaterally agreed not to bother. Adulthood. \o/
Did nothing for our anniversary yesterday, we’re not particualrly sentimental about any particular day, but it was kind of cool to be like “oh hey we’ve been married 7 years”. We went to dinner at the local club and arrived 3 minutes too late to buy tickets for the end-of-month raffle which included some whitegoods, because for some reason that raffle starts half an hour earlier than all the other raffles, which I think is some bullshit they cooked up to cut off the non-regulars like us, who sometimes turn up for one raffle and win four meat trays on one ticket, a situation they feel very bad for despite having no control over it.
I didn’t play any goddamn video games again this weekend seriously what the hell. My back hurts. This coffee sucks. I’m tired.
Only 2 months, 22 days, 7 hours and 45 minutes until Oktoberfest Brisbane! That is all!
That’s an odd way to spell AUS PAX. Also you’re off by two weeks.
PAX is old news, friend. Oktoberfest is where it’s at! 😛
AWWWW SCHIZER HUUUUUUND!!!
Morning TAY!
It was my birthday on Saturday when I was working (damn you recruitment season!), embarrassingly my co-worker told the event organizers and they made an announcement over the P.A system at the Melbourne Exhibition center that it was my birthday lol. On Saturday night I ate all of the Greek food with my family which was cool.
I also got my tickets changed for some flights I’ve been saving up for to Europe from Saturday (I left it REALLY late lol) to next year in May \o/ I also played life is Strange, and and man it’s a Strange game (Hi @strange!)
Happy birthday, fitness bud!
Cheers Mang! I played Life is Strange from 9.30-11.15pm (when I’m normally in bed, so I think it’s a good game to keep me awake! XD)
New episode tomorrow! Best spend all your waking hours catching up, home slice! 😀
Wait, that’s tomorrow? I’m so behind.
Best spend all your waking hours playing too! For me, Red. For me!
But mah moneys! I spent many hours gaming while unemployed last year and just played Skyrim and Destiny, barely made a dent in the backlog.
Right now I’m in Chloe’s room after Warren got wailed on by Nathan. Nathan’s are such dicks! Looking forward to moseying about Chloe’s room and finding some clues as to why she’s putting up Rachel Amber posters everywhere!!!Ooooh! Snooping about places is the best! Lots of stuff to explore! I’m kind of jealous you get to play these eps back-to-back to. Poor Warren! :'(Happy Birthday for @saturday!
Happy birthday!
Hippie Burt Daye
Happy birthday Kotaku!
Hurky burkday burkdie
So Inflatable World is pretty damn rad!
It’s an indoor sports centre that has heaps of inflatable play equipment – slides, jousting, obstacle course etc.
Of course, my daughter is to little to got by herself so I just had to go with her and her little friend to make sure they didn’t get stuck. Perfect excuse to act like a child again.
Otherwise made a vain attempt to catch up on some study, gave up an repaired a nendoroid instead. Sorted out some external lights. Cleaned up the vegetable patch and got it looking somewhat reasonable ready for spring.
Watched first episode of Sense8 last night and it seriously tripped me the hell out… or I was a bit too tired to follow it. Will give it another crack later in the week and see how it goes!
They need to make a sports centre like that for adults!
Had a Monopoly extravaganza on Friday night with some mates and played some Warhammer 40K Kill Team.
Saturday was lazy day at home with kids. They played some Kirby/Tokyo Jungle Mobile/Vita Pets and I played some Rocket League (platinum woohoo!) Saturday night went with my 7-year-old daughter to watch Inside Out (well worth watching – more for adult parents than kids though) and had a roast chicken and champagne takeaway dinner (mmmm…) followed by some more Witcher 3 (I’m seriously up to about 300 hours on that now).
Sunday took my 5-year-old daughter to a party and then took wife and number 1 daughter to morning tea. Had what I thought was going to be a chocolate-coated scroll pastry which turned out to be drowned in Nutella (gak!) Then went home with number 1 daughter and played Monopoly on PS4. Picked up number 2 daughter and slept for half the afternoon before youth service at night when I was on singing duty – damn hillsong stuff stuck in my head! Now I just need to listen to Isaac 365 to get over it… https://www.youtube.com/watch?v=y74nAGTo8XQ
EDIT: Anyone going to Insert Coin(s) at the Oxford Art Factory on 6 August? I have my ticket but no lovely boys/girls to go with me 🙁
A Monday Morning Question
Today do I go see:
Antman
Terrmyneighter Jennycis
Mr Holmes
The Gallows
Self/Less
Minions
Antman
Who are you seeing it with? by yourself? Go Holmes if so.
Sad no friends style.
That’s the best kind of styel!! =O
Have not seen any of those but based on the recommendations I’ve been given, Ant-Man is high up on the list and is is Minions.
Trainwreck if you like Amy Schumer!
Look at me, giving the contrarian answer that’s not on the list. *flicks fringe* 😛
Only if you like Amy Schumer.
Otherwise, avoid it like the plague
Yeah, I think that’s fair. Her comedy will either appeal or won’t and if it doesn’t… you won’t like it! XD
Who’s Amy Schumer?
Seriously, all I know is she’s got a show in the US and Lucasfilm doesn’t like her atm.
Comedian with a show on Comedy Central called Inside Amy Schumer. She’s a feminist and all body positive and sex positive. Her and Judd Apatow collaborated on new film Trainwreck.
Does this film have a point? Last Apatow film I saw was funny people and it kinda petered out. Still the best thing Sandler’s done in ages.
First film he’s directed that he hasn’t written. This is all Schumer. 🙂
I know who she is now, but literally had never heard of her till she started hitting the papers with “controversial” magazine covers and so forth. Then she’s been on shows like the Weekly and so on since, and now I do know who she is. Her marketing team are earning their money! Not sure if I can be bothered going to watch her movie at the cinema though… so I guess they still need to work at making me actually spend money.
It bothers me how names seem to pop up out of nowhere and suddenly be *everywhere* so frequently these days. I still have no idea who she is, beyond being some name that popped up a couple of weeks back (comedy friend linking crap at us again) for apparently being racist or something.
Urgh, relationship drama.
It’s a Judd Apatow film, though. Not a fan?
But yeah, I know how you feel about relationship movies after the Her debacle! 😛
He’s all over the place. Knocked Up was brilliant. This Is 40 and Funny People are amongst the worst films I’ve seen.
I didn’t mind those last two! Funny People was the last Adam Sandler movie I could stand! XD
Outside of Eric Bana though, that film just kinda waffled along with no real point.
Yeah, totally.
I felt like it was a nasty film without having anything to say about it.
I do agree that none of them have been as great as Knocked Up, though.
ALL of them!
Or just Antman.
Yes
Ant-Man, if you want typical Marvel.
Mr Holmes, if you want a nice little drama
Minions, if you feel like turning your brain off and just want to have fun (unless you hated the Minion parts of Despicable Me 2, in which case avoid at all costs)
@dc suggested Trainwreck, which is meant to be pretty good (haven’t seen it), but it’s a typical Judd Apatow (Knocked Up, 40 Year Old Virgin) in that it’s a drama/comedy that is about 30mins too long.
Avoid the rest.
EDIT: If a cinema near you is showing Love & Mercy, I highly recommend it, it you’re after a drama.
Antman is the only one of those I’ve seen, but I loved it sooooooooooo.
Saw minions Sunday, pretty good. I really want to Antman, maybe Tuesday, unless I Jurassic a world, or even more likely, go home tired.
I’ve seen Minions and Antman so far. If you want a silly kids movie, go see Minions. If you want a Marvel movie that’s similar to Guardians of the Galaxy, Antman is what you want.
Terminator for your Arnie fix or Mr Holmes if you feel like having a thinking movie. Hope whatever you see is a good one.
Go and see Inside Out if you haven’t already. It’s not a kids’ film, despite appearances to the contrary. Bonus feels if you are a parent.
I can recommend Mr Holmes.
Antman – Ive heard good things
Terminator – I actually left the cinema part way through to vomit and then came back (im not even kidding)
Mr Holmes – is a good drama
The gallows – reviewed spectacularly poorly so I think its a pirates life for that movie
Self/less – the only movie to fail worse than the gallows AND it has Ryan Reynold, stupid smug Ryan Reynolds
Minions – is literally a movie you shut your brain off to watch its cute and funny but I feltit dragged.
Trainwreck – comedy drama really well recieved apparently lebron james is amazing in it and speaking for myself im a fan of all the major actors so thats my pick
Hola Tay.
Weekend was a bit of a mess. Well, Saturday was.
Had a plan: Give blood in the morning, go out to lunch, tool around home for a bit, then go see Ant Man.
Well. That plan lasted up to step one.
BLOOD DONATION STORY LOOK AWAY IF YOU’RE A LITTLE SENSITIVE
I was back on platelets for the first time in months, which is an interesting process- they take blood out, spin it, then return it about 100ml at a time. I’d started OK, though the nurse has said the needle was giving her trouble as the vein was a bit too tapped from all the donations I do, but it should work fine. About 80% through though, the machine started yelling, apparently not finding the right pressure (which happens, sometimes). She fiddled with the machine, and it went through another cycle, but it started stinging a bit in my arm, which is not usual. I told the nurse and she just said “right, let’s cut this short,” stopping the machine, and she pulled the needle out in the usual way and gave me the usual swabs to hold on it pre-bandaging.So I’m lying there, arm elevated, when I notice the room start to swim.
“Um, I think I’m fainting”
So suddenly I’m laying horizontal, and I have a blood pressure cuff on, and I’m getting questions and nurses (nurses? I dunno if all the red cross people are nurses) all around. After a couple minutes I come good, didn’t faint, but a close call means I now have to lie there for a half hour for observation and get my blood pressure read a bunch of times… And I’m not allowed to drive for six hours. Which throws out my other plans.
So they ask how I’m getting home, and I tell them I’m meeting friends for lunch. So they give me a cabcharge to get to where I’m having lunch with people, and I have to rock up with “I need a favour.” Because friends are awesome, they managed to get me and my car back home. Meant I couldn’t go to the movies though, so Ant Man shall have to wait.
Sunday, cleaned up more of my house, then went to a planning meeting for the Terry Pratchett Fan Club’s Quiz Night. This is their third one, and it’s always science fiction and fantasy themed, so the guy who runs the club asked me to help out because I know video games as well as the rest of the material. Gonna be fun, If any of you are in Adelaide in October you should come along,
A Monday Morning Question: Science fiction quiz time! What’s a Science fiction/fantasy property you think should be included in a quiz? What game would be ripe for quiz questions? There’s guaranteed one Mass Effect question.
The last time I had to give a bunch of blood I nearly took a swing at a nurse. Coming in and out of consciousness is fun! (at a minimum I get dizzy and nauseous every time)
I’m usually fine. This is my… 30 somethingth donation? and it’s the only major issue I’ve had.
Booked again in two weeks, gonna get back on the horse… and switch arms to give my left arm vein a break.
I think Star Wars movie trivia is a given for anyone and sci-fi enthusiasts should be able to comfortably answer questions about Star Trek. Video game questions should probably be reserved for gaming enthusiasts even if Mass Effect is one of the best sci-fi things ever.
Other TV properties such as Stargate, Farscape, Firefly, Space: Above and Beyond, Babylon-5, Battlestar Galactica and so on might be a bit obscure for casual sci-fi fans. I mean if you haven’t seen the shows, that knowledge jsut isn’t culturally pervasive. I consider myself pretty geeky but I don’t know anything about Babylon-5 since I never saw it when it was on TP when I was a kid, and it’s anathema in our house since my wife considers it a shoddy DS9 knockoff and refuses to watch it so I never got caught up later in life (whereas she was all too eager to show me Buffy and Angel).
Previous years they’ve had one or two questions about each of those, so if you know it you feel good but if you don’t know it you can make it up in other areas.
Star Wars, Pratchett, Star Trek, and Potter all get multiple questions because they’re a bit more pervasive.
I feel like the Hitchhikers trilogy (in 5 books) is full of non-sequiturs and one shot gags that would be perfect for trivia.
E.g. who is Zaphod’s therapist?
Gag HalfruntWhere would you find a Fuolornis Fire Dragon?
Brequinda, in the Foth of AvalarsWhat sector is Earth located in?
Sector ZZ9 Plural Z-AlphaWhere is God’s final message to his creation located?
The Quentulus Quazgar Mountains in the land of Sevorbeupstry on the planet Preliumtarn, third out from the sun Zarss in Galactic Sector QQ7 Active J GammaOther than the sector one, they’re all probably too specific.
I threw the last one in as an “EXPERT LEVEL” (I had to look up the answer) but the others came to me unaided.
But yes. They’re specific. I thought it was nerd trivia? 😛
There’s “nerd trivia” and then there’s “crazy specific stuff that you’ll never remember.”
We already had to tell someone that no, not everyone has read The Wheel of Time multiple times.
I’m great at “crazy specific stuff that you’ll never remember and is only important to me me me”. Isn’t everybody?
I did actually know Gag Halfrunt and the sector.
Those are the ones I knew. I didn’t even remember anything about Fuolornis Fire Dragons.
Easy to moderate HHGTTGH trivia to me would be stuff like:
– How do you learn to fly?
– What’s the best way to get a drink from a Vogon?
– What award-winning feature did Slartibartfast contribute to Earth Mk1?
– What is Trillian’s real name?
– After Arthur, who was next on Bowerick Wowbagger’s insult list?
– What was the final message from the creator of the universe?
– What alcoholic beverage is known for it’s tendency to nullify a person’s telekinetic abilities?
– Who lives outside the asylum?
@kermitron Those are good questions.
Fuolornis Fire Dragons was one of my favourite one-shot guide entries (from So Long & Thanks…). See: http://www.megarezo.org/lecture/romans/hhgg/sltf_21.html
Doctor Who could be a good one to include.
Oh, that’ll be there absolutely.
Firefly
I would personally say the black jewel trilogy because I love it but probably doesn’t have wide appeal
LOTR novels
Assassin’s Creed (list all AC games released in the order they were released)
Riddick
X-men
So did something go wrong with the blood thing? Or is that just a thing that can happen sometimes?
It’s an issue with me, not the process. You can pass out giving blood if you’ve not eaten and hydrated properly beforehand (I had only had a light breakfast) but the nurse’s guess was that my vein was the issue, and when the return pressure stuff didn’t work the pain had triggered something.
Every other time I’ve done either platelets or plasma I’ve been golden.
Urgh, up since 7am…
*shoots self*
Welcome to my world, but earlier then that! 😀
This & every weekday
Coming off of uni holidays, waking up at 7am was excruciating! :’O
Not so good morning TAY,
Mondays hey!…. what’s up with that guy anyway?
Weekend was good. Finally received all my hardware for my new PC build on Friday arvo. Went home Friday all excited to start the build, then the GF tells me we are going out for dinner at the local for her dads Bday. No biggie I thought that’ll only take a couple of hours and then I can start building. Until we saw some friends in the front bar and decided to stay for “just a couple of drinks”…. I think it was 4 am by the time we got home.
Woke up very late and very slow on Saturday and had my nephews 6th birthday to go to (which we were late for), It was good with magicians, fairybread (love it) and other stuff. On the way home the GF convinced me to call into a mates house and see what they were up to. “ok” I said but only for a hour or so as I wanted to get home to start the build. Long storey short we ended up staying there over night and was up until god knows what time.
so after finally getting home on Sunday around 10:30 started the build, all went pretty well, had a little trouble with getting the Cooler on the GPU and then with cable/tube management for all the cooling tubes (probably due to my massive 2 day hangover muddling my brain) but worked through it without to much hassle. was a late night again last night getting it all together and set up, ran burn in and benchmarks and all seems good ATM. Set to download Witcher 3 while I am at work
So after having only a total of around 10-15 hours sleep all weekend (I usually use the weekend to catch up on sleep). I am now stuck at work red eyed and sleep working, dreaming of knock off time when I can get home and finally get stuck into Witcher, oh and some sleep if there is time.
no worky worky for steed, wanna sleepy sleepy and gamey gamey instead.
Sounds like you spent most of the weekend horsing around.
#PageSixIsEternal
I c what u did thurrr !
Yo! o/
Witcher though. So good.
FInally got back into it yesterday (took a Batman break from it, and Bloodborne was occupying my time) when I was supposed to be cleaning my house. What a great game.
Yeah I had played a couple of hours on my old PC, but wanted to wait for the new build to appreciate it in all its hairworks glory, I cant wait
I am almost thinking of removing myself from the equation today to allow better productivity in the work force. AKA pulling a sickie/getting the f**k outta here !
Mornin, TAY.
My weekend wasn’t too bad. Watched a cool movie (Dumplings) and finished a cool game (Bloodborne).
Did end up going to the optometrist for the first time ever though. Turns out I need glasses…
I honestly didn’t realise how bad my long-distance vision was until they sat me in the chair to do the eye test. I guess I kinda just assumed that everybody couldn’t make out much detail from a distance? I dunno. Never really thought about it much because I can read perfectly fine (even if I get a bit squinty at a distance).
Just quietly between us, TAY, I’m kinda freaking out over it just a little bit.Four eyes.
Heh. I actually have a noticable divot behind each ear and on my nose from wearing glasses since I was four years old….
And now thanks to the POWER OF LASERS I am not wearing glasses. It’s really weird. 🙂 6 weeks tomorrow since the op. 🙂
Glasses will suit you, buddy. *swoon*
You’ll be all ‘meh’ about it in a few
monthsyears.I didn’t want them but knew I needed them when I was having trouble reading the route numbers on the buses in time for them to stop for me.
Even better, get some prescription sunglasses and then no-one will borrow them!
Prescription sunglasses are the best. For some reason I feel all vain and self-conscious wearing my glasses in public, but I don’t have that problem with sun glasses.
I never wear my (non-prescription) sunglasses because I feel like they make me look too unapproachable 😛
So yeah, didn’t get prescription ones.
Yeah, I thought the same thing for a while but now I just prefer to see the world clearly. And plus, who wants to be approached any way? 😛
See clearly and save your eye balls from excessive UV bombardment!
Working for an optometry chain I can tell you there’s nothing to fear… Plus get some hornwood glasses and you can be totally hipster!
Oh the test and such was fine! Already ordered everything, just waiting to pick them up. I’m more worried about the thought of actually having to wear glasses now 😛
First little while you’ll get a bit of a sore nose bridge but you’ll quickly get used to it and then you’ll be surprised just how much you can see now 😛
Also I should actually get my eyes checked
Also behind the ears will probably hurt for a couple of days.
You’re gonna find that you’ll be forever pushing them up the bridge of your nose. I haven’t worn glasses for about 5 years now and still feel the compulsive need to do it all the time.
Depending on how air-conditioned your work/house are, contact lenses are a surprisingly cheap and easy option if you find that you hate wearing glasses during the day.
Coffee is too strong…
Eyeballs receding into skull…
Hi how is everyone?
Sith Lords update:
Got the ship back, raised my dark side, recruited some ladies.
Craptop is still crap, but what am I gonna do. (Rhetorical, no question mark).
Still a great game.
Alrrriiiiiigghhhtttttt
@kermitron & anyone else who has read all of Game of Thrones so far:
kinda dawned on my during my train ride today that John Snow really is dead & just like Robb it seemed to be leading somewhere & wasn’t really.This probably means everyone else is for the chip too & the last stark standing will be the youngest , feral one that I forget the name of.
It’ll all build up to him being the last hope but he won’t give two shits & disappear in the forest with a few wildling women he’s been shagging & the world will freeze over.
If they looked like Ygritte I would too XDSomeone get this man a life partner! :p
I’ve always like the theory that all of the starks, who start as heroes, will end the series as the villains. Snow will be an undead warlord, Bran a crazy mystic who cares not for people, Arya an emotionless assassin, Sansa a puppetmaster playing the game, and Rickon a feral savageyeah, before they all die.Seriously though:
It’ll be nice if they do give up on “The Game” as a message that all that shit is shit.Nah.
GRRM might love piling misery on the only good characters he’s got but he didn’t orchestrate Jon’s ressurrection at the hands of Melisandre just to pull the rug out and say “psyche”. The fact is from a storytelling perspective if Jon isn’t who we think he is and doesn’t get ressurrected and all that, the story really just falls apart. It’s rubbish. Sure, the story so far has been built on fakeouts like Ned being noble and honest and losing his head; Robb screwing over the Freys for his honour and being murdered at the Red Wedding, etc. But Jon being actually legitimately dead will bring most of the plot to a screeching halt. Maybe his death will be the last nail in the coffin of the Night’s Watch when the white walkers come marching through the wall and take Westeros, only to be met headlong by Dany’s dragons when she pulls her finger out and gets on a goddamn boat, but I just don’t feel it.I don’t know what Rickon’s deal is but he’ll probably turn up as a feral wolf-boy when the plot needs him. I assume the fact Arya has occasional flashes of Nymeria is also relevant even though she seems to no longer be part of “the game” what with her story shifting over to Braavos and all. The way Sansa was married to Ramsay makes so much more sense than the fake Arya/Jeyne Poole nonsense that I can’t bloody remember what’s going on with her in the books. She’s still hiding in the vale pretending to be Littlefinger’s bastard, isn’t she?
All that said, only one thing is certain.
#CLEGANEBOWL #GETHYPE
always presumed Aryan would comeback as a total badass & kill whoever’s left alive on her daily litany.There’s so much more going on in the books with that royal boy (thought Tyrion would help raise him up rather than Dany like in the show. But DoD they go their different ways before he joined the second sons? Was it the second son’s?)
All that shit with the pirates is much more involved in the book too, wasn’t there 3 narratives going? The guy on the ship, the priest & the sister of reeeeek?
As well as the resurrected Cat & friends. Did they pop up in the show beside the scenes with Arya?
There’s so much more going on that it could really go any direction. Doesn’t seem like the ice zombies are quite as fast in the book as the show. Are they even making a move really? Or did they just wake up for winter & the crows & wildlings realise they’d been playing on their lawn all these years?
The “ice zombies” are kinda what the books are about. About the Game getting in the way of preparing for Winter. By the looks of the show, they’ll be featuring more in the next book.Of course, Song of Ice & Fire, I get it.I’m just wondering if they’re really on the move yet, you know?
The tv show they’re in a swift sprint, the book seems like they’re stil scoping out the new blood, maybe sent some scouts out. Certainly not a full scale invasion just yet.
Like I said, because the show’s already gone into nextbook territory, it appears as though in the next book we’ll see them making moves.Also “Ice and Fire”…Jon and Dany. Which is also why I think he’ll still be around in some form or other.Dany & the little broDany & Cersei
Hmmm? Maybe?
I didn’t read Snow as being as dead as the show made out. I can’t remember specifics.
It’s just a thought that crossed me mind, any other series he’d be alive for sure, but this series just has me questioning different outcomes.
Just throwing ideas out there, I’m certainly no authority 🙂
Remember, I named my son Tyler, not my daughter Arya. I probably don’t know what I’m talking about ;-p
Yeah, but that was 15 years ago! I think only two books were out at the time. I only just got around to reading the last book at the start of this year. 😛
I think all of us are just throwing ideas around, anyway!
There’s no way that’s the last of Jon Snow. Robb NEVER seemed to be leading anywhere. He couldn’t even lead an army properly. 😛 He was always going to die badly. The clues and lead-up for Jon’s mother mean that there’s something more to Jon than there was to Robb. It’s always felt like the series’ leads were Jon and Daenerys.Robb was just the first that came to mind. Wasn’t there a few others that went bye byes when it seemed to be building to something? Maybe not?Oberyn Martell would probably fit the bill…Quack quack
Jon Snow still has long hair IRL…So for me Jon Snow confirmed season 6that’s just because he realised having badass heavy metal hair is da kewlist!I can’t remember exactly but
A few chapters before Jon Snow gets ganked there’s some kind of forewarning from the fire lady, it kind of implies she knows its coming, she needs his blood following that train of though might end up bringing him back to life. I’ll have to go back to (I want to say Dance of Dragons?) and check but it was definitely in the final few Snow chapters GRRM hints at this.were the others that were resurrected all that good?I remember them being a bit shit or kinda evil.
Or was that because the guy that resurrected them was a bit shit & melisandre will do better work?
She’s meant to be the most powerful of the fire priests so you’d imagine she could do a better job. Also if I’m remembering right the other priest did bring that one knight back to life repeatedly however each ressurection left scars and made it harder until finally he passes his “light” on to that Stark lady. I would imagine if Melisandre needs Snow’s blood she would be willing to bring him back but probably with some kind of catch (especially since he swapt out the babies meaning she technically doesn’t have a royal bloodline anymore). Anyone else curious as to whether the Iron Islands raiding party is going to end stealing a dragon?Man, is that what they were up to? I’d forgotten. All I remember is the woman with no tongue who is obviously up to something
Yeah that’s lady stark from the red wedding; they find her corpse in a river and something takes hold of the resurrecting Knight (I feel his name was Dondarion or something?) and he feels compelled to pass on his “light”. She in turn becomes the stone lady or grey lady and takes control of that little band of bandits who eventually capture Brienne and Tyrion’s handmaiden/squire. I believe the last book left them in a situation where they were about to be hanged? It’s hard to keep track once you reach the last 2 books cos there’s so many new arcs and characters and they’re all taking place worlds apart. E.g. I can’t even remember what’s going on with Tyrion anymore?? Is he still with the Spider?? And wasn’t there some dude from Dorne who wanted to tame a dragon?Here are my thoughts on how the final end game will play out:
I imagine it’ll be very Five Armies-esque, all of Westeros and Danaery’s armies will all be warring somewhere near Kings Landing with tonnes of death on every side. Then all of a sudden the ?White Walkers will have descended crushing Winterfell and killing everything in their path until they come upon the battlefield with all of the warring factions. They will all need to band together to fight off the ?White Walkers with the help of the Stark children and their Direwolves. Danarys and Jon make babies and take the Iron ThroneToo cliche for GRRM =P Much more likely the white walkers wipe out all life on the continent and Daenerys’s 2nd generation of kids lead an invasion =Pthis is all before the laser weapon wielding aliens are introduced? :pIf that happened I’d find every GGRM book I could find, and start a book burning. Absolute heresy.
I hear the 50 ft Bikini Bimbo from Venus will make a cameo in book 36
Late to the party, I know, but there’s a long-standing prevailing fan theory that there are five characters that are protected by absolutely impenetrable plot armour:
1. Dany2. Tyrion
3. Arya
4. Bran
5. Jon Snow
Everyone else, including Sansa, is apparently fair game. I also read some really detailed fan analysis of Jon Snow’s story recently, and it’s suspected that his mother (whose identity we don’t know) is Targaryen linked, which would be the source of the king’s blood Melisandre can smell on him.Yeah, I read that last one. I’m suggesting otherwise on the first.
No concrete evidence, just a thought (yes, sometimes I have them).
I’d like that theory to be proved wrong, but (somewhat) sadly, I don’t think that will be the case this time.
So my weekend was swell. Saw Antman on Saturday and hung out at the arcade afterwards where I played DDR for the first time in forever. It was good fun and reminded me of how much I enjoy DDR. I actually ended up really enjoying Antman, more so than Thor 2 and Avengers 2. I put it at around the GotG level of mixing action and deep plot which I’m totally okay with.
Sunday was RPG stuff, 40K Space Marine stuff to be exact. The highlight was when one of the squad leaped out of a building that was being shot to pieces and ended up tackling a Chaos Hell Talon (a fighter bomber). Needless to say the Hell Talon won that fight.
*narrows eyes*
In another life I used to play DDR a lot. Like, “a lot” a lot.
I too used to play “a lot”. If they had DDR machines at gyms, that would be my workout routine.
We should start a petition where DDR should be bought and used at gyms 🙂
…what’s a gym?
Oooooh, a gyyyyym!
One of my friends in HS had a boyfriend who actually got ordered to stop playing DDR by a doctor because of what it was doing to his ankles.
I suppose some of the mats/pads are not very receptive to button presses so I can imagine that happening a fair bit. Some people get a little bit too into the whole thing as well which doesn’t help either.
I think it must be most likely due to excessive play of the arcade version, which are solid surfaces to step on, at least if you used mats it’d help soften the strain (Or at least I think it would anyway)
Depends on your style of play though. I exclusively played the arcade versions and the pads are actually quite sensitive (having taken them apart and seeing how they work). Most people use waaaaaay too much force to activate the pad, which leads to excessive fatigue and possibly injury.
I miss having a DDR mat so I could play at home
I stopped playing DDR because it cost too much to play all the time. Also, a lot of the awesome songs I loved where removed in the pal versions of the home game.
I have Mario DDR though. I can’t play it though because Sid gets too excited and wants to bite my feet
But did you pay back the chicken?
It’s one of those mornings where I’ve got loads of housework to do, a growing pile of quilting projects with deadlines, late library books that need to go back, and games I really want to be playing, but I’m just sitting here avoiding everything and wasting time on my laptop. This never ends well. 😛
This time it will be different, though. THIS TIME.
Hah, I procrastigamed Saturday arvo in lieu of cleaning my house for an inspection tomorrow. Managed to get up to a boss in Bloodborne while ostensibly “taking a little break”
In case anyone is interested, I’m selling a 3-day pass for PAX. Apparently you can only cancel it if you’re either sick or dead.
I’m still trying to figure out if I’m going. If I come up with an answer soon I’ll give you a shout!
*waves hand around*
You will go to PAX!
Everyone is pulling out of pax meat. Worst. meat. ever.
That’s fine, who needs them anyway? *starts sulking*
How do you think @tech_knight and I feel? This is meant to be our last hurrah.
Hey, if anybody out there wants to work on games in Sydney (with me!), Wargaming has a whole bunch of positions going: https://wargaming.com/en/careers/vacancies/#367
Apart from the boring work stuff they mention, we also have table tennis and a Wii U with lunchtime Smash Bros and Mario Kart. Pretty sure that should seal the deal for anybody here.
Can I come for the Mario Kart and getting-paid parts but not the working part?
I want to work on games! I keep having ideas and it’s driving me crazy.
I can’t move though.
Do you need an office prick?
I can’t program or nuthin but I can lay about blaming others.
If I was keen on moving to Sydney I’d apply for the SysAd job (after remembering how to poke the keyboard in a way that makes LDAP work good).
EDIT: Also, I do not envy the person that has to sift through the Game Designer applications.
I think it would be great fun sifting through applications that include 200 page illustrated descriptions of tanks fighting, in space, against a race of aliens called the Ja’Ga’Huuuul, using the following range of outlandish weapons…
I wrote a script a few years back that extracts user information from LDAP to automate Outlook email signatures to a set standard. Just set it to run upon terminal server login and then sit back and watch everyone give up trying to change their signatures as they reset every morning anyway. Pretty geeky huh. Ultimately we dropped the feature when we migrated from Outlook to Google Mail.
Random, I know.
Decided on Antman now and Mr. Holmes after lunch.
There’s four people in the entire VMax cinema for Antman and one of them is sitting in my seat.
And if you physically lift them out of your seat, somehow you’re the bad guy.
Which one is your seat? One of the best things about my seat (third row from the front, in the centre) is that most people don’t like it.
How do you sleep at night knowing that your seating choice is so offensive.
Doesn’t your neck start to hurt after a bit?
No.
A: I’m kinda slightly on the short side, and B: I use my handbag or hoodie as a cushion for my back and kind of slide down, putting my feet up between the seats in front of me because there’s never anyone in front of me.
Err..I mean…YES! Yes,my neck hurts, and it’s the worst seat ever and nobody should ever sit in it!
I like fourth row centre, myself. Third’s a bit too close for my neck.
So from not going to PAX at all, I’m now going both Friday and Saturday 😛
My brother in law bought 2 passes for Friday and gave one to me…
Aaaaaaand i promised i wouldn’t do this but @scree had been an absolute champion and bought me a pass yesterday… So shout out to @scree for being incredibly generous, I am insanely grateful! Did I mention it was @scree?
@screeLook at me, I’m Doctor Pixel: Home owner!
I have nooooo idea what you’re talking about!
*twiddles thumbs*
He may be a doctor but he only deals in issues of the chest cavity. That’s all surgeon simulator teaches!
If it involves a hammer, I’m all over it!
Was that really necessary? 4 mentions? What happens if someone buys you a sunday pass? Will they get ALL the mentions?
Well I wanted to make sure that everyone knew who I was talking about 😛
I’m still a little unclear on it.
My response is to just shake my head.
Yeeeaaah i get that a lot /o\
I could’ve found a reaction gif, but lazy
In the distance, thunder booms. Wait, no. It’s something far more ominous. The echo of a cash register closing its drawer. A text from my sister proves my suspicions correct.
“Saturday what is this animal crossing sequel i’m reading about”
“it’s not a sequel it’s just a side game where you design homes”
“and theres cards you can buy?”
“yeah it unlocks stuff in-game”
“I will buy them all.”
Out of dreadful curiosity, I pick up my sister’s 3DS, it’s activity log reading approximately 1326 hours clocked into New Leaf. That number will continue to rise even into the distant future, I think to myself.
OH GOD I NEED TO CHECK ON MY VILLAGE! WEEDS, WEEDS EVERYWHERE! AND COCKROACHES!
All my villagers have moved out except for the ones that I hate!
Move out, Gloria! Damn.
I want to grab the game, but not just for me. I think Mum will also enjoy it.
So. My weekend, Friday I was doing An out of hours server change, for the third week in a row.
Got home at 3am Hooray!
Saturday, we cleaned the house a bit, picked up groceries and then cleaned up some more.
Then we went out to dinner for Date Night, because we havent seen much of eachother lately.
So while sitting at an expensive restaurant having excellent food (http://nelrestaurant.com.au/food-menu/#mix) I got a call from a friend saying she’d been given tickets to Blur.
Anton is british and a child of the 90’s so you can pretty much hear the squeals of joy already.
Needless to say, we had a pretty excellent date night. 😀
Sunday we cleaned the house a bit more in preparation for @trjn staying over.
then we went to a friends Birthday yumcha lunch (spring rolls omnomnom)
Once we got home I made Brownies and then it was time for BOARD GAMES!
@cj @cookingmama and @novacascade all came around and we had some fun games
Cosmic encounter
I was all set to win with Bunny and Nova, but then Bunny had to make me lose 3 colonys didnt he. Which took me from 4 points to 1.
Betrayal at house on the hill
Anton ended up being the Traitor and that was a lot of fun
Such a fluke win! Hooray for finding a secret staircase at the exact right time.
But poor CJ, pretty sure he died, technically he didnt, but pretty sure he did.
Tsuro
So much fun, after two games we ended up playing blind (put a tile down without seeing it) Just soooo much fun.
Thank you all for coming, we had so much fun.
Cosmic! I think that’s my next big purchase.
Betrayal… I dunno, it’s always left me cold. It’s a deeply weird game, from the dice on up.
Cosmic is amazing. Definitely worth a look in.
Betrayal is a mechanically poor game that can tell some great stories.
I know, I played Cosmic with you 🙂
I remember. I don’t know if, after two plays, I’m at the point where I’d buy it though. A few games with the more advanced aliens would have to happen to get me across the line.
Admittedly, if I’m going to spend some time in Sydney, that’s going to happen.
I had a great time! Cosmic Encounters was fun, I’d definitely play that again, and I think I’ll track down Tsuro, that’s a good one to play with kids 🙂
Wait, it’s Monday already? … Freaking Anno. /._.\
Had a great weekend. Got out of the house on a Saturday morning for the first time in months, as I had to take a trip to Hornsby to pick up a guitar – I’d been considering upgrading from my Les Paul Jr since around November-ish, and found a great price on a second-hand-in-name-only Les Paul Custom – still in the original wrappings (mostly). Thank god for uni students buying expensive guitars, only to realise they prefer playing drums. :3 Spent an hour or two just noodling about in Rocksmith, rediscovering Session mode… strings needed a good clean, and likely a replacement soon, but an absolute pleasure to play once I’d cleaned the strings and stretched them a bit.After that, I didn’t feel like jumping into an RPG, so I played through Journey a couple of times. White robe achieved! …with a scarf that doesn’t even reach the ground, as I’d only missed two glyphs on my first run… need to go gather the rest for this playthrough, I guess.Still had a few hours before I expected to see anyone on Destiny, so I started a game of Anno. Was just getting back into the swing of things – remembering my production layouts and supply chains – when i realised it was way later than I’d thought. Jumped onto Destiny (apparently missing a huge PSN outage?) for some noodling about and prisons with @trikeabout, until I was ready to collapse around 2… which I now realise means I would have been up for 20 hours straight by that point, which explains Sunday’s fatigue…Sunday was spent realising how badly everything was actually going in Anno, and scrapping everything I’d built and starting from scratch – grabbed as many islands as I could as quickly as I could – got three of the four major islands before the AI, and did a better job of anticipating needs. Got up to 1200 engineers, and had the start of a good tech base on my third island, with all needs taken care of… and then it was 7 o’clock. Jumped onto Destiny long enough to realise I was too tired to play, so moved to Rocksmith for half an hour before calling it a night.Anno 2070? Or is there a new Anno I’m not aware of?
Yes, sorry about the late night. It was fun though! And productive. Apart for “Where’s my cipher???” Grrr.
Last night I downloaded the foxtel app for my la[ptop so streamed the Grand Prix while I Destinyed. Bit of a Nightfall and took the n00b through his 32 prison, so he’s got he first 42 light armour piece.
Then flicked the tv on and stayed up way way too late watching a very soggy peleton arrive in Paris. 🙂 The good news: no more random cycling chatter in our Destiny fireteam for a while.
Well, Anno 2205 is coming out later this year… 😛 But, yea, this was 2070. Was going to play 1404, but only had 2070 installed, and didn’t want to wait for updates.
No worries – had a great time with you guys (although dying to teleporting cabal in the 34 boss arena was a little annoying). I’m sure you’ll get a cipher, but it took me about 18 34s to get one from that, so it might take a bit of persistence.
Aww… I was enjoying the chatter. 😛
I should really reinstall Anno and think about playing it again. 😉
It was fun. Hoping the 35 roll is a little more forgiving this week so I can have a crack – running out of weeks.
😉 Tour of Spain will be here before you know it, and you can be regaled with random strings of European names and time gaps…
Cosmic was so much fun, I do want to play it more often though, so that I can start playing the yellow or red powers.
Oh and over the weekend I started playing Dragonball Xenoverse too. They wished for a supremely powerful hero, and they got one: https://twitter.com/PowalenAU/status/625227181795381248
ps. I have Cha La Head Cha La stuck in my head.
Caterpie seems like a worthy hero! BUT HE AIN’T NO CAPTAIN DUMPLIN!
@alexpants has failed you if you don’t know who that is 😛
Edit – also, pc or?
I actually haven’t really watched that series myself, so…double failure!
Son, I are disappoint!
I’m not much of a fan of watching people play games (generally speaking I’d rather play them) but The Adventures of Dumplin’ are incredibly entertaining, more so if you like DBZ Abridged.
I’ve watched a few of their gaming compilation videos which include bits of Dumplin, but I haven’t really enjoyed them much, which is a bit strange.
Dumplin as a character though is hilarious. One of those compilations had some scene where he’s just gazing into the camera while Trunks has a conversation with you and I was in stitches.
So to answer your question I don’t know.
(◉‿◉)
Best.emote.ever!
HEY!
PC, indeed!
Seemed to be chugging a little bit on my computer last night though. Might have to check my settings.
I agree with @rize! We should totally get some 3-people thing going!
I’m sorry, I believe you have him mistaken for DEMON GOD DUMPLIN!
Such a great song (and game!)
We should Co op soon again, I still haven’t completed it
Worst.
Also, I spotted Pow on DBXV on Steam on the weekend, so we could totally rope him into 3 player lag-time!
You mean “Pixel carries the team while @rize is punching air or vice versa”-time? 😛
SPECIAL BEAM CANNON!
*taps shoulder* “Uhh…the fight is over there”
…”DADDY!”
Just give me a while to play through the single player first then I’m all yours!
Just FYI Parallel Quests (the non-story stuff, where you can co-op) are fine to jump to before finishing the story, and at certain points in the story you kind of have to (depending on skill/fighting style) to get through certain fights.
Oh, also, forgot on my weekend list: Played Rocket League with @shane! He thrashed me, and then we both got creamed by the AI.
Good fun.
Whoops! It’s lunchtime already?! The parcel guy always drops off a regular parcel for Mr. Strange on Monday mornings so I told myself I’d do something productive once he got here. But he hasn’t even been yet. Dammit parcel guy, my morning is all gone! 😛
OMG is your husband a drug dealer
It might not be that bad. Maybe he’s just an addict.
I feel like this is the perfect opportunity for some kind of meme…
Yugioh on Netflix?!
ITS TIME TO D-D-DUELLLLLLL
Watch out for his trap ca-
Damn, you activated it.
I’m just watching the very first episode of Pokemon for the first time in many years. I’d forgotten that the pokedex is a smart arse. It Keeps giving Ash lip. He deserves it though. He’s seriously one of the worst trainers in the pokemon universe. Though he’s better then that bastard who abandons his charmander.
Ash’s ineptitude bothers me so much, and the story keeps finding colourful ways to say that it’s because he likes the challenge.
Maybe he should stop upping the challenge because he CONSTANTLY LOSES.
I like how this comes across in the game too because once you win Oak is all like “hells yeah, you won because you love your pokemon” because the game was targeted at kids who had no idea of min/maxing and probably just picked whatever pokemon they thought looked cool. You read now about aggressively breeding for the best EVs or whatever, and tossing unwanted pokemon because they have the wrong nature and all of that and the game is still all like “yeah, love and bonding, not just power and competition!”
It’s almost like the show is mocking people by making Ash such a loser whose Pokemon only learn anything because he’s constantly being hounded by Team Rocket. Then again, I wonder if Ash might have time to actually train his Pokemon once in awhile if Team Rocket weren’t constantly trying to steal Pikachu.
Yeah the exp he must have been getting from facing Team Rocket so many times must’ve been so minuscule… that must be why he keeps losing. Team rocket never won those battles so they never levelled up
Keep thundershocking that Onix! I don’t care that it’s rock vs electric, keep going!
Thunderbolt the ground type!
…It worked!
It worked because love and trust and FUCK YOU, AUDIENCE.
Friendship is OP in any anime… only thing that annoys me in anime more than “The OP power of friendship” is fan service 😛
You’re basically defining the entirety of the Naruto series =P
Friendship, dreams, ambition, pretty much anything you can draw out into a long flashback filled yell while throwing a punch. It wouldn’t bug me that much but they always lead up to it by explaining why using their 100% accurate undeniable power level measuring system this fight can not possibly end with the hero winning.
That said One Piece makes me cry every damn time they start screaming about friendship…
The first few times it feels epic but then it gets very repetitive if they keep doing it. One Piece have done it well that there’s more than one hero that can kick the enemy’s arse, it’s not all Luffy
At least Pokémon Origins got the ‘following the game rules’ thing pretty right.
It’s so good & a little disturbing
The one where Brock explains the rules and basic battling strategy ends with Red completing the Pokedex. The one where Brock chooses to follow Ash around cooking for him sees Ash leave the region with maybe a dozen Pokemon, most of which he didn’t capture himself. There’s probably a life lesson somewhere in there.
That’s when we find out that Ash’s Pikachu has a unique ability: this Pokemon can hurt any Pokemon, regardless of type immunity.
The Pikachu is basically superman at this point
Wait, so you’re saying Team rocket was right in wasting all this time and money trying to capture a Pikachu?
I would be okay with this interpretation. At least a little bit of sense is better than none.
TAY RPG Pathfinder on tonight at 7:30pm ACST and 8pm AEST. Starring:
@redartifice @tech_knight @freezespreston @negativezero @beeawwb
You stand before an adult Black Dragon in a cave that’s filled with Troglodytes and Giant Lizards. What will you do?
http://s223.photobucket.com/user/Korath_photo/media/Dragons/BarbarianVSDragon.jpg.html
ooh, a Larry Elmore piece, nice,
I should be there and I really hope we get to rest up soon, I’m so lacking firepower if this goes south -_-
I think I mentioned it last time but, because everyone leveled, you can recover up to your level in spent spells ie. any six spells that you expended, regardless of spell level, come back to you. So you won’t be entirely out of power if a fight goes down.
Plus you will have access to any new spells that you may have obtained. It doesn’t affect anyone really and I’m not about to penalise you too much for being the only prepared caster. I’ll handwave it by saying that your journey from Newfort to Aulde Phorte gave you time to recover some of your spells that only really came back to you over time.
Or, better yet, magic happened. *waves hands*
Oh okay! I must’ve either missed that or misheard you, I’ll keep that in mind tonight. Thanks, oh mighty powerful GM!
I’ll keep it fair regarding the access to spells so that I can only add to my already existing lineup for the day and not replace anything, so I should have access to very few extra spells, but it’ll be enough.
And please for the love of the Omnissiar, don’t let this come back to bite me 😛Huh. So Antman just took me by surprise by actually being fantastic. Wasn’t expecting much. Was definitely a Marvel movie though and the formula is getting a little tired.
One question
His ex wife and her new husband are obviously very well off, big house and a $100k BMW out the front and both are harassing the guy that can barely afford to feed himself for child support? What kind of horrendous spite monsters are these people?Re spoiler: most realistic part of the movie
My guess?
Maybe just reinforces the whole “once a criminal, always a criminal” thing the movie had. Or, on a broader note, how the burdens of the past pretty much overshadowed the main characters and turned into a millstone around their necks. Once they atoned for their past, then they could move forward into a brighter future.Probably reading too much in to it, but in many States in the USA child support isn’t related to the costs of raising a child, but rather the costs of raising a child in the standard previously enjoyed. So, if they lived a similar or more extravagant lifestyle before Señor Copman was on the scene Mr Thiefy might actually still be liable for some payments. Stupid, hey?There’s legally entitled and there’s holding someone’s child to ransom to someone who can’t meet it. She must really hate him.Now I’m enterring the realm of speculation but child support arrears also are registered against a person and don’t go away. So, if when he went to prison, she registered for child support and he accrued debt then he’s actually still liable for it and in some states would have his pre-tax wages garnished to pay towards the debt. But yeah, it’s still assholey.“Scotty needs us! Ain’t nothing gonna stop us! Ain’t nothing!”*police everywhere*“…Back it up. Just back up it. Yup. Back it up”Michael Pena needs to become the dude who just shows up in every movie like Coulson used to.
“…Back it up. Just back up it. Yup. Back it up” – His daddy taught him good.This got me thinking about how I’d rank the Marvel stuff now that “phase 2” is finished.
Guardians of the Galaxy
Captain America: The Winter Soldier
Iron Man
Daredevil
The Avengers
Ant-Man
Agent Carter
Iron Man 3
Second half of S1 of Agents of SHIELD+
Avengers: Age of Ultron
Thor
Captain America: The First Avenger
Thor 2
The Incredible Hulk
First half of S1 Agents of SHIELD
Iron Man 2
It also made me realise what bugged me so much about Age of Ultron. The comedy was very similar to Ant-Man, however the tone of the movie definitely didn’t fit all of the forced funny pieces in the middle. While Ant-Man’s comedy flowed and made sense for the source material, AoU’s comedy bits detracted from the seriousness of the situation.
If the characters don’t take the situation seriously, why should I?
AoU spoilers (kind of, mostly playing it safe)
I saw Klaw’s arm ripped off and I should be horrified. But instead the movie tells me to laugh. Dozens of people are dying because of Iron Man and Hulk’s fight, but Tony is cracking jokes. Cap and Thor casually joke while taking out Hydra soldiers with a single tap of the hammer and shield.All this while we’re supposed to grow fear and dread over a cold, lifeless machine wanting to eradicate humanity due to its sociopathy.
Honestly, the biggest problem with Age of Ultron was Joss Whedon’s directing style. I love him but let’s be honest: everything he does is ridiculously similar in style and tropes, so it gets jarring when trying to make the film more personal and serious.
I love Avengers 2, easily my favourite Marvel movie.
But yes, funny Ultron was a silly idea.
For me, Winter Soldier is still far and away the best of them. It has an interesting plot with some actual twists, great characterization and character development with an interesting human angle to it, and generally well-produced all the way around. No jarring comedic elements either. Rewatched it on the weekend and it held up much better to a second viewing than Guardians did for me.
I’d rate Daredevil very highly as well but I don’t think it’s fair to compare it to feature films. It’s a different affair.
Reinstalled Empire Total War because I hate myself, and I love the ludicrous scale of it all, and started a game as the Dutch (technically, it’s the United Provinces).
I then proceeded to spend three years with one of my ports blockaded, because I didn’t realise that I had a fourth province, because I am a good leader.
My mighty naval fleet has spent 90% of the game fleeing from pirates, because I split it up to take control of trade nodes (which will pay off in the mid game, hopefully, maybe).
And my Army has been camped outside Amsterdam, alternating staring at the floor with staring at the sky, the trees, and occasionally little birdies.
I am the best leader the world has ever seen.
You’re probably doing a better job than existing world leaders =P
So what you’re saying is, you’re avoiding unnecessary conflict and loss of life on principal, you appreciate the wonderful scenery in your great country, and…you…don’t like……ports.
I fucking hate ports. They killed my parents!
Spent all day Saturday at the Eagle Park Range in Little River, just outside Werribee. Went with a mate and sighted and ran in a few rifles between us. Was my first outing with my Remington 700 Police as well. Amazing day. Nice little spot too, reasonable weather as well, if not a little windy.
Surprised how much it took out of me too. Took several hours to run the barrel in – one shot, clean, one shot, etc. Ran about 40 rounds through it and considered it broken in. Next 20 were trying to narrow down the zero, and managed roughly 1″-1.5″ groups at 100 metres. Nothing to write home about, but will fine tune the scope as well as what ammo and projectiles my rifle prefers.
Surprising how much your shoulder hurts after firing 60 rounds of .308 Winchester. (or 7.62mm, whichever you prefer.) Although it was fine the next day. Will be making a regular thing out of this, methinks. Maybe twice a month. Nice to get out of the house and spend a day with friends doing something we all enjoy.
My Saturday : http://imgur.com/C6H9bo2
Apologies if anyone’s an anti-gunner as well, let me know if this stuff isn’t welcome – can be a tetchy subject for a lot of folks. For me it’s just a pastime I get a lot of enjoyment out of. If it’s any consolation, I’m not a hunter – I just enjoy the engineering and mechanical aspect of firearms, as well as the challenge of shooting well. Hugely rewarding.
If you’re not hunting (and a sane, rational and responsible person) it shouldn’t be a contentious issue any more than any other non-contact sport.
Except for the part where 100m rifles are easy mode and you should pistol it up 😛
As a very strongly anti-gun person, I’d say that even hunting isn’t an issue, so long as you’re not shooting at anything endangered, and you more or less follow the law.
It’s when you start yelling about the right to carry a gun with you at all times, to have them easily accessible in your house for protection, or if you’re arguing that a Barrett 50 cal or an assault rifle are practical weapons for hunting that I will have issues (Well, I mean they’re both very good options for killing things, but I think you get my point).
This. I don’t have anything against hunting – even though I’ve decided it’s not for me. As long as it’s done ethically and professionally, it’s actually necessary in some cases, and beneficial in many others. As far as vermin and population control goes. As long as hunters are skilled enough to ensure clean kills, and it’s done by the book, I don’t take issue with it. It’s dickheads that do dumb shit like trying to shoot a big animal like a roo with a .22 or something, or just shooting everything for the sake of it, or for sport/trophies. It should have some sort of agricultural or pest control benefit.
Again, just not for me. My interest is more as a ‘gun geek’, I guess.
I’m not against hunting on the whole (though there a frequent public examples of how not to do it) but I’m happy to accept that it IS a very dividing subject.
I almost would go down the pistol path if it wasn’t expensive enough as is playing with rifles! Also a pistol license is much, much more heavily controlled. Lot of work involved. Maybe later down the track.
But trust me, a .308 kicks like a mule. Breathing and other various techniques involved, even at 100m. Will be pushing it out further in coming visits. Was pretty happy we initially bore sighted it completely by eye and got it smack on the bullseye at 50m.
If you’re not insisting you need it for protection, have to carry it everywhere in public and keep it locked up when not using it I don’t see the problem?
Thanks for being reasonable. I’m a firm believer in doing the right thing. As far as Australia goes, gun ownership is a freedom, not a right. I do all I can to ensure I represent responsible ownership in all aspects of the sport.
I think someone gave me similar instructions for the use of my penis.
Hunting’s come up here before (I remember getting into a spat about it with @liondrive) but I have no issue with target shooting.
My gun issue is with guns in non sporting, urban environments.
Urgh.
I absolutely despise hunting.
I find it utterly disgusting.
Out of curiousity how does having a gun work in Australia? Do you get a permit to carry?
Not at all. I think there’s exceptions to carry for some security licenses, but not for your average citizen. All firearm ownership is very strictly controlled in terms of storage and use. As far as rifles go, all rifles and ammo need to be stored separately in a locked safe with different compartments, bolts removed. (with different keys, obviously) Any safe under 150kg has to be bolted down, and over 150kg can be free standing. During transport by car, they rifle and ammo are to be stored separately again – ideally rifles in boot with bolts removed, and ammo inside, preferably in a locked container. Any transport of your gun is to be done to and from your destination, with no deviation. No stopping at your local shopping centre and leaving your guns in the car. If it gets stolen, it’s on you.
Licensed owners are subject to regular inspections by the police, and any infractions will get your license revoked pronto.
This is for Victoria, by the way. I think most states are about the same, with some variations in regulation. But all are very, very serious about enforcing regulations.
EDIT: Also, all firearms are registered with the Police on purchase. They know each and every gun you own, and you have to be able to account for it’s whereabouts at any time as well.
I could be wrong, but I think NSW had some parts of gun control that are *more* restrictive than most other states.
And yeah, in terms of carrying you can only do it as a (heavily) licensed professional, like in security, armed forces, police etc. That’s not to say whack jobs never get this right, there’s just a lot of control which helps.
Yeah, and nor does it stop a bad person getting a black market/illegal firearm, which all the legislation in the world won’t make any difference to, sadly. More a customs and importation issue.
It does remove a lot of the weaponry from circulation though providing fewer avenues for a determined individual to resort to. And they would have to commit a criminal act in just obtaining the weapon providing more situations where they could be caught.
Removing many of the guns from circulation does help keep them out of criminals hands to some extent by driving the price up. You’re average drugo Isn’t likely to drop a few thousand on a gun to go and hold a convenience store for $200 and change.
Christ sounds like a shit ton of work; I can appreciate the precautions being there though =P Does this also extend to bows?
Actually not sure – I know there’s some rules and regs regarding bows – just not entirely sure what they are.
I’m not going to lie I’ve always wanted to set off a few rounds of a hand-gun, know how to take one apart, etc, etc. Same goes for a bow, I should look into a gun-range and stuff in NSW see what the deal is =O
On principle I’m against weaponry; but hey it’s a gun range and I’m curious =P
If it’s something you’re interested in, start doing some research. Get out there and have a go. Most ranges or gun clubs will be happy to advise or assist with any enquiries – most want people to start out right and know what they’re in for.
I’ve been a little surprised by the innate distrust and sometimes distaste levelled at me from people at times regarding firearms and gun ownership. I expected it, but still surprised me. But I decided it’s something I want to do, I partake responsibly, and if that isn’t enough for someone I don’t much care. If you’re interested, don’t feel guilty about it.
Yeah I think I’m going to look into either a hand gun or a bow, not sure how comfortable I am keeping a hand gun in the household though so maybe just try out ones they have in a gun range.
@pupp3tmast3r My knowledge is a little rusty (and this may be state specific) but you’re not allowed to store a gun at your house until a certain time period has passed. It’d be stored at the range you *have* to regularly attend to justify owning owning it in the first place (as per licence restrictions).
Go for it. Pretty sure you can just book a session and just rock up and shoot – seemed to be the case when we did it for a work do a while back.
Definitely one of those things it’s neat to have done.
I don’t think there are many rules regarding bows other then their use that applies to anything (It’s as illegal to kill someone bubble wrap as it is to kill them with a bow and arrow.)
I think it’s because of the skill and effort required to use a bow they aren’t really used in crimes of passion very often.
Crossbows are a different matter though. I think they might be more heavily regulated then guns. Might not even be legal at all in some states.
It’s a lot of work on purpose. One of the simplest ways to stop a person doing something is to make it inconvenient.
Put it this way: how many people would eat McDonalds if it was inconvenient?
One time I wanted to eat McDonalds but the entrance was at the top of a flight of stairs so I went to the KFC that was on ground level instead.
See?
SEE???
Very summarised (simplified) answer: You can get a permit to use a specific type of gun in a controlled environment, or as a farmer for pest control
Not an anti-gunner, just an anti-let anyone have a gun.
You seem sane, so go for it 🙂
Wise Emperor Jimu approved!
*bows regally*
Nothing wrong with sport shooting on a range. Target or clay, whatever. Likewise firearms used for essential vermin control seems fine to me (much rather see foxes and rabbits shot than chased with hounds and torn to bits, or given some disease…). What you’re describing is a hobby, done in controlled conditions and handled responsibly.
I regard it no differently to petrolheads – what’s a reasonable hobby when confined to the garage and trackdays, and mods are done carefully by people that know what they’re doing, becomes antisocial and lethal when some idiot is drifting on an open public road or does dodgy mods on the cheap that compromise a vehicle’s handling or safety.
Basically, it takes all sorts, and if you enjoy shooting, great!
I haven’t shot for years. Used to have a .22 air rifle in the UK and pop cans off a fence (with suitable back fence to catch stray pellets!), and I did do .22 rifle shooting and occasionally go clay shooting with a mate of my dad’s. Pretty comfortable around weapons in those circumstances.
However, even after 10 years in Oz I still get a little creeped by cops and even more so non-cops like PSOs carrying handguns everywhere…
To add to the fun: if you use any air powered gun like that in Australia (and were caught, obviously) you would be arrested and be charged with a bunch of things.
Like wanton destruction of precious antique cans.
Indeed. Much stricter here.
PSOs make me a little uncomfortable too.
I find it slightly unsettling when you walk past a couple of guards emptying an ATM and they’re carrying pistols. I get that they’re supposed to be a deterrent but the idea of shooting someone because they took money is…fucked.
Remember catching a train once and train guards were checking tickets and one of them was hyper aggressive, hand on the gun and snarling at everyone, making sure they could see she was a half second from drawing the gun. Felt really uncomfortable then and I hadn’t even done anything.
I believe @SerNobulus was on the same train and had the same experience.
…wait, you have train guards with guns? Why? So they can shoot you for dodging a $4 ticket?
The transport officers in NSW I’m pretty sure don’t get guns and for good reason. A crowded train is really not the best place to use a gun. Probably more likely to hurt someone other then the person you are aiming at.
That’s the range I visit often with my brother. He hunts often too but I’m more into the target shooting stuff.
What sort of guns do you guys shoot? Saturday was my first visit to Eagle Park, was really pleased with the setup and the staff. Super friendly and quick to bail people up if they weren’t doing something right.
I’m a bit of a gun geek myself. I like looking, shooting and holding weapons, just not a fan of people using them to kill others (outside of self defence). I have a couple of books on weapons throughout history, and a couple on snipers. I keep them hidden though because I’ve had people get weird on me when they see these books on my shelf, or as currently being read on goodreads (which posts to FB as well).
I used a basic .22, my brother has other guns too. He also has a 308 but I didn’t shoot that. My license has since lapsed since then so I just go to watch mostly now days. I have since suffered a permanent shoulder injury, so if I am to shoot again I’m going to need a gun rest, and a new license.
Guns are scary. But I find them fascinating. Loved reading this.
So how bout that weekend huh?
Was super tired friday night so figured I would hit bed early. Checked the parcour for the TDF and didn’t see anybody taking time on the final climb so figured it was going to be fairly straight forward so I could skip the stage. Heading to bed a bit before 10 and just thought I would check who was in the breakaway. See Sky obliterated on the 1st climb and think bugger it, going to have to stay up now. Interesting stage but headed to bed before the final climb
The woke up early and headed into work Saturday, and then stayed up late to watch the queen stage. Again most enjoyable but needed sleep.
On Sunday Mrs Tigs took Tiglet to a market which gave me a glorious sleep in. Then had fights with Mrs Tigs as I was grumpy and hungry and she was switching plans about so I had no idea what was happening. Tiglet had a 20 minute sleep in the pram but still wouldn’t go down. Ended up heading around to a friends place to play board games.
Tiglet just smashed it out and didn’t want to sleep at all and stayed up the entire time we were there, until about 8pm. Didn’t get to play to much, 7 wonders was in progress when we arrived so offered some advice there. Mrs Tigs jumped into that game and I had a drop in drop out game of apples to apples. Then I played splendor for the first time, really like the game and not just because I won.
Started trying to setup xcom which I was going to watched but in the end they decide it was too complex to do 1st game without anybody who knew. The only people who knew the game were locked away in a big match of Tikal. Mrs Tigs had a round of San Jaun and Spendor as well while I chased Tigelt around the room and introduced her to the Puppy dog. headed home and finally put her down and then cooked up the left over meat and watched a dragon riders.
All in all a nice weekend
Bought a Friday & Saturday tickets for PAX last night. Don’t know if I should cosplay again or not.
Hopefully I’ll get to meet up with some TAY peoples this time around.
I will be, so you have to as well. Those are the rules I’m pretty sure.
Well I always abide by the rules! Just got to figure who to cosplay as.
Cosplay as Pow!
Tay meat?!
Quite possibly, I haven’t really been following the details though so I don’t know what’s been organised.
It’s Saturday night, 7 pm onward at a theatre with karaoke. It’s $35 as well, which covers the fee of hiring the place.
Cool, I’ll have to see if my friends have planned anything on that night, if not I’ll come 🙂
Who needs friends when you have STRANGERS FROM THE INTERNET! 😀
Do it. I like costumes and I’m too lazy to make my own, so you motivated types have to pick up the slack.
Where did that weekend go?
Ended up going around to Dare Girl’s place on Friday night, watched a few movies. Then slept for most of Saturday before my friend came around, and after some screwing around trying to make computers work eventually got to playing Diablo 2 for the next fourteen or so hours, with a short pizza break in the middle. Then slept through most of Sunday. Til I got curious about Torchlight 2, and then aw crap I’ve stayed up all night again.
I’m not sure how I feel about these games. I mean clearly they’re addictive as hell, but I’m not sure I overly enjoy them that much? Definitely prefer Torchlight though, despite being practically identical there’s a whole bunch of modern design sensibilities to it that much the overall experience so much more pleasant. But still, at the end it just feels like a constant grind for bigger numbers, with very little “actual game” behind it. Which isn’t meant to put them down at all, more just a crude way of expressing my gaming preferences – I’m not that big on menu-type games like Pokemon or whatever, I prefer something that’s more about coordination and skill (eg sniping in Splatoon) than just number crunching when I play a game, that’s where I get my fun. These ones feel like maybe a step above menu-based RPGs, just point and click on the thing you want to die next and tap a couple of other keys to occasionally switch around what abilities are getting triggered.
Actually, it reminde me of my initial non-multiplayer time with Minecraft. I played that for hours and hours on end, but still didn’t enjoy it. It was just kind of constantly working towards some goal that was never actually met.
Action RPGs main draw is the “more numbers” thing that you’ve pointed out. It’s the same reason why standard RPGs like Fallout, Skyrim, Mass Effect, Witcher, etc still rely on levels, perks, and better equipment to form a base for their game while delivering a plot to go with it. Diablo, Torchlight, and other similar games often show you in loot because they’re meant to be a test of skill and praising RNGJesus. That’s the entire game.
I admit that I enjoy ARPGs more than a lot of other games but I don’t disagree with you at all. They’re banal and simplistic compared to other games.
Best feeling in Torchlight 2 is finding a new weapon, using it on your next enemy and they literally explode 😛
My engineer is extremely fond of his great hammers 😛
I tend to feel the same way. If a game is all about progression and getting higher numbers I can get behind it, I can even get really into it, but I’ll only enjoy myself if the core gameplay is good. Diablo is fun for a while, but once the time between milestones starts building up there’s just nothing in it for me.
All games can boil down to ridiculous simplicity. Splatoon you’re essentially just moving a cursor and clicking on things. It’s Windows Explorer if the files were moving around.
I had a feeling once I’d typed that that there would be a response like this 😛 Couldn’t think how to word it better though.
I guess it’s the particular method of input for these games that does it for me. I mean playing Borderlands co-op with the same friend, that was still generally the same grind-for-loot-and-bigger-numbers deal, but it felt like there was more of a game around it than here.
Just got a call from Mum, saying Nonna’s gone. It’s like she was holding on for them to get back from their trip over the weekend.
Kinda relieved, tbh. Though suddenly feeling it more than I was at any other point leading up to it.
Aw man, hope you’re OK.
Sorry for your loss, bud. 🙁
Sympathies friend. *beams good juju Gooky’s way*
*hugs* sorry to hear that, hope you’re ok
Yeah it hits you like a ton of bricks when they actually pass even if you think you’ve prepared yourself for it. My condolences gooky =\
My condolences mate, I’m sure your being with her in the past few days would mean a lot to her.
Just got an email stating that my replacement PSU from PCCG due to be shipped today (after waiting a month for it) has an update. Thinking it was confirmation it has been sent, I opened the email.
New shipping date.
21/8/15
…give me my refund, I’m going elsewhere.
Are they delivering it to you personally … on foot?
The fact that I’ve been waiting a month and a half already makes this so much shittier than it should be.
Just finished watching Mr Holmes. Was a unsure at the start, incredibly British, but after a bit it picked up a bit and I thoroughly enjoyed it.
Can recommend.
Just checking out that picture of the Sombrero Galaxy…. Man looking at the multitude of galaxies in the background makes you realize how completely insignificant our little planet with life is. Maybe in another life I’ll get to physically explore each and every one of those stars *dreams the afternoon away*
Edit: Hell most of the galaxies in the background probably don’t even look the same anymore 0,0
Small is not the same as insignificant. =P
Or you could buy elite: Dangerous
So, I bought a second wired 360 controller, and I’m thinking of trying Steam’s In Home Streaming with Rocket League.
Has anyone on TAY tried it, and, if so, what’s it like?
Works fine for me over WiFi to my laptop (pc is wired to router) but I’ve only played slower paced turn based or India titles.
No Idea how it would stand up to something moving quickly and what the input lag would be like.
Saw some people talking about Animal Crossing on the first page, exhaustingly copy pasted from my Facebook wall 2 months back to you today. My return to Animal Crossing New Leaf.
Loaded up my Animal Crossing game for the first time in 2 years.
My town was called The Ghetto, character/mayor runs around in a monocle and a do-rag. Weeds everywhere. Find a seagull passed out on the beach. “Man I’m so unconcious right now” it says to me. Check in at the office, townsfolk are upset the ghetto is under developed. Want more public works and upgrades to the town. Go home, house full of cockroaches. Run into some parrot. Wants a new catch phrase, make him yell cracker all the time. Being a parrot living in the ghetto it works on two levels. Save game and exit. Time to forget about it again.
Gotta keep the role play going I guess.
Rocket League. I realised to my surprise that I’m only three trophies away from a platinum. It’ll require a few extra hours of gaming that I wasn’t exactly planning to invest, but all I need to do is play another seventy or so matches, and that’s it. It’s still fun, so I’m considering it…
We should organise another TAYbie match sometime 😀
It was super fun playing with full teams and chatting (even though I hardly spoke)!
TAY RPG Pathfinder completed for another night. Starring:
@redartifice @tech_knight @freezespreston @negativezero @beeawwb
GM Summary: Got the loot, killed the Lich, left on amicable terms with a Black Dragon. Probably the best terms that you’ll ever have with a Black Dragon.
It’s nearly 3am… and I could really go a lemon iced tea right now…
http://www.lifehacker.com.au/2015/07/windows-10-free-upgrade-what-system-requirements-do-you-need/
According to this, my win98 machine could have win10 put on it. Well, except for that WDDM thing, not sure what that is. Also ew, needing an account.
Has anyone else tried World of Warships?
Pyrean and I have played it a bit and it’s not bad. I feel like it could use a few more features such as weather and water depth but it’s pretty fun in it’s current state.
It seems a bit to simple on first glance as essentially all you have to do is point your ship in the direction of the enemy and fire at them with your guns and, in some cases, torpedos. But as you play it you quickly learn it can become complicated fast.
Because you are fighting of a distance of KMs you have to allow significant lead when firing cannons (and oh so much more for torpedos) as well as trying to predict any change in speed and/or direction of your target.
Of cause you are trying to dodge to make it harder for them to hit you back as well but this is complicated by the fact that all turrets have a finite rotation (aiming) speed so you are also trying to make sure that your turrets are in position when you are ready to fire. You also have to try and make sure that the maximum number of turrets possible are in a position to fire at the enemy as they usually have limited arcs of fire least they blow holes in your own ship. All this whilst trying not to run into any islands or allies. A task that can be trickier then it sounds as generally you are shooting more or less perpendicular to your direction of movement making aiming and steering a tricky prospect.
you can be set on fire, components can be critically damaged and you can be opened below the water line causing flooding so you also have to judge when the optimum time is to use your damage control ability. You also unlock more abilities as you advance through the tech tree and unlock different kinds of ships.
Plus, managing to weave in between torpedos makes you feel like a boss.
However, as a wargaming game the grind is pretty bad and I’m pretty confident it’s only going to get horribly worse as I work my way down the tech tree.
It doesn’t seem to be Pay-to-win yet but I wouldn’t be surprised if at some point they add cruise missiles for just $1.49 each!
Ping @batguy
@batguy got me into the beta but then I went to Japan and then got fired and things went all screwy and I haven’t had time to get into it. It seems pretty rad though, although somehow the whole lol-soviet-things-are-strongest still managed to creep into it, with eg the Murmansk (an early model Cruiser the Russians borrowed from the USA on Lend-lease and returned in such a state of disrepair that they had to fumigate it to kill the cockroach and rat infestation before she could be scrapped when it was returned). Some of the power tiers are messed up as well, since basically it’s the US Navy vs the Imperial Japanese Navy, and they’ve tried to make sure that each side has ships at each tier that are roughly on par, which means that to balance out the utter shitbox destroyers the USN operated they had to pull the teeth of the IJN destroyer lineup – last I checked several advanced classes eg Matsu, Akizuki, Shiratsuyu classes aren’t in the game and you have to get ridiculously high into the tech tree to hit Fubuki.
Ep 4 of Life is Strange is out today. Already available on PS4, not sure about other platforms!
<3
Still haven’t played since I was in Chloe’s room watching her ‘self medicate’ two nights ago, I WILL get to Episode two by tonight even if it kills me!You can do it! I BELIEVE IN YOU!
The new stuff coming in this Splatoon update looks great. In the trailer there was a
squidkid with a straw hat! Straw hat!TFSplatoon?
Completely different! Splatoon is more than just hats, you know!
…you can get shirts and shoes too.
INNOVATION! \o/
squidkidsquidGonna be king of the
piratessquids!The catch is they have to use friendship to win every match!
He’s made of ink!
How did that happen?!
Yo yo yo, he took a bite of squirt-squirt!
AAAAAAAAAAAAAAAAAAAAAAH!
SO KEEEEEEEN!
I know right, straw hats are pretty cool.
CAN’T WAIT TO PLAY WITH ALL THE TAYBIES!
I’M SO FREAKING EXCITED BUT I HAVEN’T EVEN HIT 20 YET.
Ahem. I’m a tad excited/happy
*sings to caffeinated beverage*
It’s like you’re the only who really understands me, caffeine. I love you, man.
Dear Taybes,
Last night I perfected my guacamole recipe, and I had it for dinner and it was so so so good. I can return to my home planet now.
Love, Jane
Dear Jane,
Why would you try to poison yourself like that? You have so much to live for!!!
Love Nova
Boo,
BOOOOOOO!
Boo,
BOO I SAY
I’m too lazy so: ^^ what this guy said
Dearest Jane,
Hey!
Your friend,
Dan.
Dan?! WHO’S DAN?! I CAN’T HANDLE CHANGE DAMMIT!! *short circuits*
Sometimes when people call me Dan I look around for @dkzeitgeist.
You’re right to be paranoid.
Dear Jane,
I don’t like Avocado, but I am told by Avocado lovers that my recipe is pretty good.
1 Avocado,
1 tsp Lime juice,
Salt and pepper to taste,
pinch of chilli flakes.
Stir
What do you do with yours?
Love, GingerChris
Replace the chilli flakes with a bit of Cholula. Trust me. I’m not a doctor.
Dear god man, I was aiming for subtlety not murder 😛
Cholula is murder? Really? I’ve got some sauces you should try. They’re not hot. Promise. >:)
I basically do the same, but I’m a fan of sour cream in guacamole. Not too much, but enough to make it deliciously creamy.
I hate avocado and make Mr. Strange taste my guacamole to see if I’ve got the balance right. My recipe’s similar to yours except I use a half or whole lime(depending on how juicy it is) because we have a lime tree so I may as well use them, fresh chilli, and fresh coriander leaves. People say it’s great and there’s never any left when I make it so I’m guessing that’s a good sign.
Lime Tree? Do Ceviche.
…I hate seafood.
Once we had about 10 limes that needed to be used up so I made this cake that starts with simmering the limes whole to soften them, and then squishing the whole limes up with the rest of the cake mixture. Best cake ever.
I’ve made that cake with oranges. It’s so good
I did lime curd tarts when I had a surfeit of limes a month or two ago.
Other than one fucked-up batch of curd they went quite well.
Dear Jane,
I’m kindly requesting for
myall of TAYs well being that you share your perfected guacamole recipe prior to your scheduled departure.Many thanks in advance,
Sunsoar
PS. If any avocado haters are reading this over my shoulder *points to the door* you can leave that way.
I don’t eat it, But I will cook it for people, what can I do?
Just, kinda, hang around towards the back there.
No, further back.
Back.
Ok there.
My friends Sunsoar and @gingerchris86
Please see my recipe below!
– 1 large Hass avocado, delightfully ever so slightly soft to the touch
– Philadelphia Spreadable Cream Cheese
– Sweet chili sauce
– Spring onions
– Lime juice
Mash your avocado lovingly with a fork; add in your cream cheese at a ratio of about 1:3 with the avocado (this will always change depending on the yield from your avo – sometimes those pesky seeds are enormous!). Mix until smooth in a nice chunky way. Add in about two tea spoons sweet chili sauce and a good splash of lime juice, and your finely diced spring onions, and combine well.
Enjoy with: corn chips, regular chips, crackers, bread, meat, burgers, by itself 😀
Yours in guacamole love,
Jane
YOU GUYS HAVE MADE IT! YOU’RE IN THE GUACAMOLE CLUB INNER CIRCLE!
Where’s the Coriander, Jane.
WHERE’S THE BLOODY CORIANDER
I know, I know! Like, I have no problem with it, but sooooo many people do.
But those people are wrong*
*Actually Coriander tasting like dish soap is a genetic thing. Those poor genetically inferior types are missing out because Coriander is the bomb.Whoa, I had no idea!
http://www.nature.com/news/soapy-taste-of-coriander-linked-to-genetic-variants-1.11398
I always manically laugh at my sister when she says it tastes like soap…
I just add more to the guac so there is more for me.
Also, paprika is amazing in guac.
*smoked paprika*
I can only handle the teeniest tiniest sprinkle. Goddamn Scoville sensitivity 🙁
MORE GUAC FOR DINNER TONIGHT 😀
Huh, I knew the genetic thing but not the soap thing. The most common complaint I’ve heard about it is that it tastes like dirt.
Sweet chilli?
And here I was thinking you were an okay sort. Was thinking. Not anymore.
You’re not a fan, or you think it’s wussy? ;P
Just hate the taste. But then I don’t really like sweet things. Give me savory any day.
Makes it awkward when in an office and you won’t have a piece of the birthday cakes. The ladies who organise it always seem to take personal offense that I dont like cake, happened in every job I’ve had.
FInally… I thought I was by myself!
Get all this baked stuff at work – cakes, tarts, slices and I grimace every time.
Have just learnt it’s better to accept a piece, take a half hearted mouthful, place the rest on a plate/napkin for remainder of day and deflect questions about whether or not I’m eating it. Then ditch it in a bin before going home.
I generally prefer salty/savory over sweet (although I do still love chocolate, but I don’t care too much for donuts, cakes, waffles, etc). I think the sweet chili just gives a teeny hint of tang to the guac that it’s otherwise missing – it’s a small amount in the grand scheme of things.
The continued adventures of Blaghs in Empire Total War: Idiot ruler, genius commander, apparently
I began my real (total?) war by declaring war on pirates, aligning myself with modern day Australia. Unlike the fruitless battle here though, I managed to capture both their provinces (turns out undefended provinces are easy to take), and eliminate them from the game. Which left me with two unhappy provinces that were bleeding money.
Seeing my new financial weakness, one of my neighbours declared war on me. As a masterstroke of tactical form, I sat what remained of my European army in my capital, and watched as my opponent threw themselves against my walls.
As I stared confused at their army another force swept in and took their city, removing them from the game so that peace could return to my land.
So I declared war on the French, took two of their American provinces (turns out undefended provinces are easy to take), which started bleeding money and formed the cornerstone of my new civil unrest. Not happy with this much unhappiness, I then assaulted Paris.
As I continue to write the book on modern warfare, I must commend the French on their brilliant tactics. After I knocked a hole in their wall, they proceeded to slowly funnel their troops out, into a waiting semi-circle of guns that mowed them down. What I didn’t expect was that due to a miscommunication, 18 of my 23 casualties were due to my own cannons, not the enemy’s attacks. Genius work.
Satisfied with my extremely happy population (unhappiness was in the double digits in Paris, which is an achievement), I retired, safe in the knowledge that I would return to a prosperous land, particularly since Spain declared war on me in response to the capture of Paris.
I see you share my genius for strategy. Always ensure you troops are more afraid of you then they are of the enemy.
For the food lovers,
I made Stuffed capsicums last night,
Risotto rice boiled off and then fried with Onion, Mushroom and Baby Sweet corn.
With that we served some Crumbed Veal. Really Nice 🙂
Stuffed capsicum is so rad. If often make it with a mix of soft cheeses and flavoured balsamic vinegar.
I make single-bite nachos in capsicums and mushrooms – so good.
Omg that somehow made me think of making single serve lasagna’s in Capsicums….
Time to buy more capsicum…
Yes! I love teeny versions of big meals. I made this awhile ago – it’s about an 1.5 inches squared. – http://static1.squarespace.com/static/52a474b4e4b0d82de8bb5240/t/53113b8ae4b0ff95a86f3a10/1393638284053/zuccloseup.JPG
I love caramelised balsamic vinegar – to the point wife and I drive out to Mt Tambourine (90 min drive from Brisbane) to buy it because we can’t find it in Brisbane.
This is the one we buy: http://www.fuchs.net.au/product/caramelised-balsamic-vinegar-250ml/
Heh.
You drive 90 minutes for Fuchs’ sake.
Capsicum is almost as bad as avocado. 😛
I like stuffing the miniature capsicums. Rice & lentils is a nice mix
Was there anyone trying to find a copy of Discworld Ankh-Morpork? The board game is out of print but I found two copies on shelf at Good Games – Central in Sydney. $70 + $15 postage. It’s a good price. If anyone is keen, send them an email.
Pretty sure that @freezespreston was hunting for one
Dear Splatoon talk,
Please stop making me want to buy a Wii U.
Sinceriously,
Lambo
You’re a squid now, Lambo…
You’re a kid. Now.
If it helps at all in my opinion you shouldn’t buy a Wii U for splatoon,
Buy one for Bayonetta!
Buy one for Wonderful 101!
(wow that’s a mouthful)
So I’ve officially been sucked down into the depths of J-Drama… It was really only a matter of time, come to think of it…
Last night I watched a show called “No Dropping Out” about a 35 year old woman who goes back to high school for some reason. It was stupid, ham-acted, didn’t make sense… and I loved it.
Don’t cry for me… 😛
There was a show a while back with Stephen Colbert in the cast called Strangers with Candy. It was about a middle aged prostitute who goes back to high school and it was hilariously terrible in the best way.
FOOD PAGE 3
HOW GOOD IS FUD
UNSURE. SEND FUD.
I LOVE FUD!
Probably too much, to be honest.
Need to start planning the menu for Can’d Meat though, which is the perfect excuse to cook some outrageous things.
Hopefully if I make something to bring again this year it won’t be a bitter disappointment! 😀
I keep thinking of contributing a food thing, and then I don’t because I’m shit.
Might try a bit harder this year.
Nah, if I’m not busy in the kitchen I might have to actually talk to people or socialise or something, which just isn’t on.
Unless this is a veiled criticism of my cooking, in which case cook away!
GET THE HELL OUT OF MY KITCHEN.
Nah, I mean bring something relatively pre-done, like baked stuff. Or, more appropriate to my cooking abilities, a bag of chips.
Mun-chees!
Remember last time when I brought that beef jerky along and everyone nearly died?
Good times.
Are you making Blagh’s patented chicken…things…again?
Yes? Yes.
Oh man, that green sauce dealy.
My world is upside down.
One thing I was always sure of in life is that people suck. Myself included. But there’s been an increasing amount of events in my life where people are genuinely nice and I don’t know how to react to that because I’m only used to people being sucky! 😛
Karma?
Yell at them. Talk condescendingly about how people of a different age to them are so much better. Shiv them so that nobody will question your position on top of the “definitely-not-sucky” pile.
Oh wait, no, seriously, act like your elderly age prevented you from noticing. Age is your greatest asset. :p
I found something similar myself – except I found that me being cynical or assuming people to be crap bastards, sometimes led me to automatically assume people were being crap bastards even when they weren’t being crap bastards.
TLDR: People are crap bastards, but sometimes not as much or as often as you think.
Mum just walked into my office to tell me (with great relief) that The Canberra Times didn’t have anything about my Dad’s paper, and that it looked as though the hospital wouldn’t fire him.
…
What the hell has my Dad been up to in Alice Springs?
I heard he was surgically attaching springs to someone named Alice. Your mother was worried because every newspaper would’ve jumped at the pun opportunity headline if they found out about this.
The NT news doesn’t need an opportunity to make a pun.
What happens in Alice Springs stays in Alice Springs.
I get so easily distracted on Google maps these days. On the bright side, I now know that the following places exist in Australia:
Stonehenge
Texas
New Mexico
Bald Nob
Diehard
It’s also hilariously appropriate that Bald Nob is right near Diehard.
I like to think such things are not accidental.
Iron Knob is also a place.
I used to think that would be a hard one to beat but after finding a new Nob I’ve rubbed it out of first place.
I’m sure you did…
Unsure if the first half of that was intentional or not but bravo anyway 😛
I wasn’t sure how well each joke would go together, but I pulled it off.
I have stayed at the pub there.
There’s a place near me called Condong that makes me giggle everytime I drive past.
The product I used said no one would be able to tell I was balding
*runs off crying*
One of the signs my train passes by every day says “Welcome to beautiful Balls Head!”
And every day I giggle.
Mobile data cut out for some reason so decided to check up on the work computer.
Ewwwww. What’s with that giant pop up ad for Self/Less that covers everything? That’s not obnoxious at all. Stuff like that is what makes me reach for the AdBlock button.
So what’s the deal with cookies?
How do I achieve Subway cookie softness that keeps?
I understand that brown sugar and molasses are more hygroscopic than your regular processed white sugar. And underbaking them. But the batches I’m doing just don’t retain sufficient softness 24 hours after.
Does anyone know what I’m missing?
Also, ingredient effects for your daily cookie education.
Eat the cookie dough unbaked!
Hello raw egg salmonella!
Hello?
Just saying that most cookie dough and cake batter has raw egg in it, and eating it uncooked is generally not a good idea unless you like getting food poisioning.
If it’s a cookie dough without egg, eat away!
My understanding (and backed up by a quick, bias-confirming Google) was that infection rates for salmonella in eggs is far less in current times than when that piece of advice started circulating.
http://www.slate.com/articles/health_and_science/medical_examiner/2014/03/salmonella_and_raw_eggs_how_i_ve_eaten_tons_of_cookie_dough_and_never_gotten.html
This is true, and in large due to modern egg processing. But if you have home grown eggs, and if you’re pregnant or immune compromised , salmonella is still very risky. The recent outbreak in melbourne at the Langham hotel sent 6 people to hospital, made over 30 sick, and one pregnant woman almost lost her baby after she went into labour 5 weeks early.
True. As a relatively healthy adult male with store bought eggs, those very valid concerns didn’t factor in to my bias / response. 🙂
One way to significantly reduce the risk is to make sure the egg shell cracks cleanly and you don’t get any of the outside of the shell into the whites. Salmonella bacteria are most commonly on the egg shell in Australian eggs because of the fact the outside of the eggs are not thoroughly scrubbed.
In the USA by contrast, they scrub the eggs which rids the surface of most salmonella, but can actually push the bacteria through into the whites directly as well as weakening the surface and allowing contaminants to pass through.
Pfft, what would you know about cooking, Cooking Mama?
Wait.
That’s a somewhat horrifying concept to me, considering how much I enjoyed the Japanese tendency to include a raw egg in all sorts of rice or noodle dishes. 🙁
I’ve been meaning to do that all over the place with food here to help give it that Japanese flavour!
As @beeawwb said, it’s mostly not a problem. The salmonella tends to come from the shell of the egg, so if the eggs are clean, crack free, and good food handling is used, the risk is low for most people. And there’s nothing finer than a soft boiled egg on udon noodles. (plus I LOVE oyako don)
As I mentioned earlier, the biggest risk is for pregnant women (salmonella and listeria are both dangerous), small children, the elderly or anyone else who might become severely ill. The culprits are usually things like poorly cooked chicken or mayonnaise type sauces where it’s been made and then stored for a period of time, or where cross-contamination has happened from poor food handling.
It’s mainly something to be mindful of when making food, especially for other people. For cookies and cake batter, things like Vegan No-Egg (primarily tapioca flour) and chia seeds can replace the binding role of egg, and are perfectly safe to eat raw.
Yeah but the raw egg cooks itself with the heat of the food you’re pouring over it and also it’s fucking delicious so I’d take my chances with it nine times out of ten anyway.
D:
Store them in a bucket of water.
The answer isn’t “just keep adding more maple syrup, it’ll be fine”. You’ll just have to trust me on that.
You can google the ingredients. My guess is the copious amounts of margarine & palm oil. Also, egg definitely stops biscuits getting crisp, which is why you should never use a recipe for Anzac biscuits that has egg in it.
The tears of all those that have tried before.
It might also be the baking, rather than the ingredients. Try a lower temp, and maybe try cooling them under a clean teatowel so that they steam, rather than crisp.
Subway cookies are cooked from frozen. Not sure how much of a difference that would make but it could be a fun thing to experiment with. Most importantly, it’s going to give you an excuse to make more cookies.
I use this recipe and it seems to work pretty well.
Generally stay soft for a few days – and if you try to eat them before they’ve cooled enough you’re lucky to get it to your mouth without it falling in two.
I’m guessing that the Subway softness comes from them being baked every day and fresh when you buy them.
Every baked fresh cookies is the reason for this I believe!
Yet again, I find myself wishing that Steam listed prices in AUD. “Oh, that game’s only $12.99!” *buys* … *receives receipt for $18.46 payment* … *cries*
If the government gets their way and they have to add GST to everything, we might yet see prices in Australian dollars.
From that point on will determine whether we’re using dodgy key sites and US gifting friends to buy games or just going with the regular storefront. 😛
Yep.
However, it does mean getting less screwed by Paypal’s conversion rates, which means sub-$20 games will be slightly cheaper than they are now, as GST won’t apply…*reads news: “GST threshold for imported online purchases could be reduced to $0″* Oh. Oh.
Well done me. I just said the following sentence to my regional director:
“So Company X has dropped them like a hot potato and Company Y is now up the proverbial creek.”
I’m pretty sure such lame attempts at disguising swearing makes it sound worse rather than better.
Atleast Company Y has a paddle right
My old computer chair had completely fallen apart so I went to get a new one yesterday. The Officeworks I went to didn’t have the chair I wanted in stock, so I had to go 20 minutes to another one to get it. It’s a pretty good chair. It has arm rests. Hopefully it doesn’t fall apart as well.
Also got a new pair of shoes. Normally I just wear sneakers, but these new ones are what I believe are called “skate shoes”. Just like all the cool kids are wearing.
I really like the chair I have, but for some reason it occasionally lowers itself(for a week it’ll do it constantly, then be fine), and the screws that hold the seat to the base slowly undo themselves.
So my chair is haunted, but it’s too good a chair for me to worry about it.
I have a lamp like that. My grandma gave it to me for my birthday when I was about ten, and occasionally it’ll just start flickering like I’m in a horror movie. I like it too much to ever get rid of it though. Haunted items are the best.
Wait a minute. Does this chair lower when you’re sitting on it by any chance?
Generally yes, though it will sometimes lower on its own.
It’s stupid quiet at work so I’m mulling over what uni subject to take next and can’t decide… Have to pick from the following;
Business Communication (sounds like complete drivel but has to be done at some point)
Financial Management
Monetary Policy and Risk Management
Employment Relations
Business Law
Contemporary Issues in Entrepreneurship and Innovation
Decisions decisions… *gets distracted and reads Twitter*
Entrepreneurship. Hands down.
It looks super interesting and a subject I really want to do but I think it’s going to be tricky taking a meaty subject and studying enough to get the most out of it with family commitments. Might be one I stash away for this time next year when wife is on leave and has a good handle on having 2 kids.
I say that topic for two reasons.
1) my second degree was innovation and enterprise and I’M SO ALONE NO ONE KNOWS ABOUT THE MATERIAL EXCEPT 50+ YEAR OLD PEOPLE (which is precisely the wrong demographic for entrepreneurship)
2) Australia’s innovation infrastructure and systems are horrifically bad. Some of the lowest industy/academia collaboration rates in the OECD.
From a purely educational perspective and something you’re likely to use in a career I’d go with Monetary Policy and Risk Management/Business Law. Probably the two most useful units I ever did in uni; right next to sex, power and corruption in asia =P
P.S. looking at those units looks like a BBuS?
Certainly is a BBus… The long lonely route studying online 1 unit a time juggling growing family and full time work. Sucker for punishment but I’m actually enjoying learning new ‘real world’ stuff.
I work in a company where there is a Risk gate opener/modifier on our performance reviews so would be interesting to know a little more of the bigger picture… but @highperformance mentions it’s a heavy unit and I also need to balance that with a pregnant wife.
Tempting to take Business Law or Business Communication to cruise through to a the 6 month break I’ll take after (basically so I’m not prepping for an exam when next baby comes along!)
Nice dude; as far as I’m concerned everyone should do either a Law degree or a business degree at some point in their lives just to appreciate the complexities of the systems we live in. Are you majoring in anything within the bachelor’s?
Business Law is fairly easy since you’ll be able to get the foundations of the unit just by asking yourself “what would I consider to be an ethical practice in the formation of a deal”. The whole unit can be summarized with “be fair when negotiating a deal”. It’s the bread and butter for more complex units like corporation/taxation law *shivers down spine*
Risk and Monetary policy was a weird unit when I did it; half of it deals in macro-economics and the other half dealt with statistics and cost management calculations. I never liked the risk management part personally; but I reckon learning about monetary policy is a must. At the very least it’ll teach you how our economy’s influenced on a larger canvas. So yeah maybe do this when you’ve got a bit more of yourself to spare cos it’s pretty heavy stuff.
Finance is the major and right now trying to figure out what to use my electives for. I don’t like any of the official minors so I’m tempted to ‘build’ something myself and was leaning towards Information Systems.
Studying via OUA so I’ll need to investigate just how ‘flexible’ the electives are allowed to be!
Appreciate tip for Risk Mgmt/Monetary Policy – removes a candidate from the pool for next study period.
Somewhere, a physicist chortled quietly.
That somewhere may have been at my desk.
Fine fine =P I can appreciate that, my heart lies with science but my brain lies with business! If we didn’t live in a capitalist society I would happily wile my years away in a different field of study.
I have a degree in science. I don’t work in science. There are reasons for this.
Mmm…
Unethical, undocumented experiment gone wrong and now the Pentagon has actually implemented CONPLAN-8888?????
Or… Money? 😛
@sunsoar77 put it this way: if this line of questioning continues, keep your eyes peeled for black helicopters
*a million vomiting emoticons*
I had to do one law subject in my degree and that alone made me hate life 😛
MP & RM fo’ tha win!
Students take that unit at our Uni and whilst it’s a difficult and heavy subject there is more and more focus on Risk Management in every organization so being across policies etc. can only be a good thing.
*Takes University marketing department hat off*
Anyone here shop at Myer?
Be interested in purchasing $250 of Myer gift cards for $200?
25% ROI……; hmmm. That said I’ll probably burst into flames if I stepped into Myer so I’ll pass =P
How does that make sense?!?!
Super tempting though…
Hnnnnnngggggggg…
Yes… Yes…. give in to the dark side my young padawan..
(I’m really bored at work)
$200 you’d use is far more useful than $250 you wouldn’t.
Although, don’t Myers gifts cards work through the entirety of the Coles-Myers group?
There’s Coles-Myers ones and just Myers one. I ran into that trap once when I gave my wife some once and she couldn’t use them anywhere but Myer. After loudly complaining at the Myers service desk for 45 minutes they eventually gave up and swapped the cards for us.
Yes I was one of those customers. Still, not like the parent company was losing any money so it shouldn’t have been a problem.
Cool I could get one whole pair of socks for that!
I’m interested… do I have to pick the card up in a dark alley though? :O
Of course not. Vacant lot in the far suburbs
Nah, junkyard at midnight.
Or postage, with that whole interstate thing.
Got them from work but I don’t shop there.
Hit me up at …(picks email address from hat)… jormungand(underscore)xix(at)hotmail(dot)com
Bored at work.
Does someone want to attempt to teach me something interesting?
YES! Did you know the P/E ratio of a share is effectively the amount of time a company will take take to make up the cost of that investment through its earnings? As such it can act as a gauge for the health of the company’s earnings as well as the general investor sentiment for the company’s ability to continue to make money!
YAY KNOWLEDGE!
Edit: Disclaimer – it’s technically more complex than that; but consider that the gist of what a PE ratio effectively tells you =]
So a simple use of it is in calculating the apparent ROI on a trade?
ROI is influenced by income/capital return over an investment; PE can’t account for that directly however it does account for it in a sense. It’s a direct relation between the share price of a company against (typically) it’s yearly earnings. I.e. if a company has a PE ratio of 16; it would take the company 16 years to make enough money to buy back all its shares at its current share price. This means investors believe that the price they’re paying for the share today (in theory) can be supported by the company for the next 16 years at current levels of earnings; share price traditionally goes up over time because as a company’s revenue grows they believe a higher price is justified (this doesn’t affect the PE ratio thought).
However when a company’s PE ratio goes up it means investors see growth in the company’s earnings before they’ve actually happened and are willing to pay a premium price for greater expected growth (the reverse is true when PE ratios go down). Now the trick is finding what what the standard PE ratio for a company should be and figuring out if it’s current PE ratio is at fair value; discounted or inflated. Let’s take for example Australia’s largest banks; they traditionally have PE ratios of 13-15 however more recently ANZ has dropped down to 11.8 while they others are still holding at their usual ratios. This means that the price investors are willing to pay for ANZ shares now represent a sentiment that they feel the companies earnings can only justify current share price for the next 11 years as opposed to other banks in the sector that have a standard of 15. If we assume the other banks have set a standard for what’s a decent PE ratio within the industry then ANZ is trading at a discounted rate; the question to ask then is why is this the case and are the reasons enough to justify its current trading price to be a discount or is it still inflated.
To summarize PE ratios will allow you to gauge the possible ROI on an investment; however it can only give you a glimpse. The rest needs to come from research and educated opinions =]
Here’s an interesting footnote/trivia – Large American stocks traditionally have PE’s well into the hundreds; e.g. NFLX currently has a PE ratio of 239.29, going off what you know about PE ratios now why do you think this is the case? =]
Investors are putting a big bet that the recent crazy jump in subscriptions (especially from Australia [assuming they’re one entity in this regard?]) is going to directly translate into a massive profit increase in the future?
Good one Rize; yes the reason NFLX has such a high PE ratio is because investors are expecting exponential capital/revenue growth; in fact a quick search shows forecasted PE ratio for 2017 is expected to be 99; meaning analysts are expecting massive growth in revenue over the next 1-2 years and have priced that into their expectations. One could argue this is quite a risk-driven view on how to invest.
American companies (especially those in growth sectors like tech) usually have relatively high PE’s and this is only partly driven by their expected revenue growth. The other factor in this equation is dividends; American companies typically pay low/0 dividends back to their investors especially compared to Australia stocks; preferring rather to invest all their excess capital back into the company. This has the double sided effect on PE ratios; one it adds more fuel for capital growth inflating P/E’s, and it also removes a factor that brings down P/E ratios from calculations which is dividends paid per annum which has an inversely proportional relationship to the PE ratio.
Hope I’ve given you some insight into investing =p
If I wasn’t just about to leave I would try and dredge up the least interesting thing I know that I could teach you.
I mean, I guess I could just type about medical record rights in Australia, but just typing that has nearly made me fall asleep.
I actually learned a bit about them when I was studying privacy laws in Australia. We were using fake medical data as a part of a database subject when learning SQL.
The shocking twist that no one could have expected was that database security is hard.
Step into my tent young padawan.
We’re gonna talk about Dendrimers.
Most people would have done chemistry at school, and have done something to do with polymers, whether it’s the nylon rope trick. Basically, you get a polymer when you attach organic molecules in linear chains.
A Dendrimer, however, is what you get when rather than attaching polymers in a linear chain, you attach them in a branching structure (schematically Like so, but in a 3D structure.
This class of molecules has a lot of exciting prospects. You can functionalise the outer groups, so you could make them stick to certain cells by attaching an antibody to the outside. They also have an inner volume, so you could put a drug within the gaps, functionalise the outside so it can get through a cancer cell wall (cancer cells are more porous than regular cells), and make it break down within the cell for targeted drug delivery.
They’ve got a bunch of other cool stuff, as given they’re bulky but distinct molecules they may lead to things like synthetic blood.
*crickets*
When logged into a terminal server, why is it that when you select Start/User/Lock, it’s not the same as simply hitting the Windows Key + L? And how do you combat this when a user has used the second method despite multiple instructions to use the first, essentially locking themselves out of their own computer?
I’m pretty sure you already know about this, but I have no solution. I’m hoping you could teach me actually..
If I remember this correctly, you can’t pass the windows key function through an RDP session in the same way ctrl+alt+del can’t. Like most restrictive issues, it’s a security feature to prevent these functions being intercepted/imitated by dodgy stuff.
Alt+Home will open the start menu but I don’t think there’s a pass-through keyboard shortcut for locking. I guess the technically correct answer is you shouldn’t be locking an RDP session 😛
EDIT: By “technically, don’t” I mean an RDP session is not designed to sit there indefinitely, it’s far happier as a jump in-jump out connection. The frequent issue with terminal servers is that they’re either never set up correctly or their performance is so shit it’s not feasible to log in only when needed.
When I shadow another user’s session, how do I combat that damn Caps Lock switchover when they have it on and I don’t and then suddenly their Caps light is off but Caps is on..
Restart machine, I know. 😛
Edit the machine’s registry to reassign caps lock to shift 😀
…probably don’t screw around with the registry.
I will teach you my best playdough recipe. If you have kids/nephews/nieces, a batch of this stuff is a perfect rainy day activity, or a fun present. It takes about 15 minutes to make and is MUCH cheaper than the shop stuff in tubs.
2 cups plain flour
1/2 cup salt
2 tbsp Cream of Tartar
1 tbsp fine glitter
2 tbsp vegetable oil
Put all of these ingredients into a large bowl and give them a mix. Then mix the rest in a heatproof bowl or jug.
1 cup boiling water
1/2 teaspoon liquid food colour
Add the coloured water to the flour mix while it is still hot. Mix the dough with a knife until it starts to come together, and then mix with your hands. A large mixer will also do the job. Knead the dough for 5 minutes until it is smooth. It should be soft, pliable and slightly bouncy to the touch. If it feels too crumbly add a little more water. If it’s sticking to your hands or the bench, add a sprinkle more flour. Store it in an airtight container or zip-lock bag and it will keep for 1-2 months, depending on how often it gets used (it tends to dry out before it goes mouldy, because of all the salt)
Might give this a go this weekend! My daughter lost her mind the first time she was introduced to playdough…
I’m a Playgroup coordinator, and playdough is our number 1 favourite activity, so I make a batch every other week.
Is the salt and cream of tarter enough to dissuade them from eating it?
Substitute with sugar and you’ve just saved yourself having to cook them dinner as well.
But don’t add eggs because Salmonella.
Generally yes, and this recipe has less salt than some other versions. The cream of tartar doesn’t have a flavour though, it’s there to stiffen the dough so it holds shape longer. The bright colour and glitter seems to give the most indication that it’s not food. We have maybe 1 kid in 20 who actually eats it. Most have a taste and then leave it alone.
There is always one
I found a recipe that uses jelly mixture. Takes a bit longer than your recipe as takes a while to cool down. Comes out smelling amazing and is exceptionally soft and pliable.
It doesn’t have the shelf life though and ours went mouldy in the fridge a little while after week 2. I think that’s because it’s got a fair bit of sugar in it.
I’ve seen a lot of recipes from the US that use kool-aid as well, for the colour and smell. Shame it’s hard to get here 🙂 Honestly though, I’m happier if the playdough doesn’t look or smell too appetizing. It’s for playing, not eating.
The trick with the colour is to use lots. When I’m mixing colours for playough I measure in quarter-teaspoons, not drops. Gives much better colour. Paste colours work well too, but because they cost more, I prefer to save them for cakes and just use the cheaper liquid colour in larger quantities.
EDIT – have a look for playdough circuits. Salt playdough will conduct electricity, and sugar playdough won’t, so you can use it to build simple circuits with LEDs and a battery.
Use red glitter and colouring, and call it redstone 😛
The 5 Why’s
Developed by Sakichi Toyoda, this particular form of iterative questioning involves reviewing a problem and then questions the reason for the occurrence of said problem.
For example: Your company can’t find a strong candidate to work in your company.
Why?: Candidates are applying without the requisite skills
Why?: We don’t have specialist recruitment knowledge to write dis-ambiguous job descriptions
Why?: We haven’t employed anyone for this specific work function
Why?: Because we broke AF
Why?: Because we didn’t budget properly to hire a person like this
This theory of reasoning is a cause-effect relationship between a problem at hand, and attempting to discern what the root cause of the problem is so that you may address the problem at it’s cause rather than at only a superficial level.
5 Whys? Reminds me of when I try to explain something to my kid.
Hahaha this was my thought when my colleague was explaining the process to me today, I just kept saying why when she told me about a problem she was having.
She regrets telling me about this now.
I guessing that is because you throw up your hands after 5, not because they ran out of whys
The 5 Why’s – Developed by
Sakichi Toyodachildren under 8.More seriously, I make frequent use of this process but was not aware it was a documented thing. It’s very useful in identifying an issue and breaking it down into more basic problems. But then I hit the usual hurdle of someone with authority to action a required change digging their heels in…generally because money 😛
But that’s when you do the 5 Why’s again when you can’t get authoritative action stage: I can’t move on this with project
– Why?: My boss won’t sign off on helping me with something
– Why?: Because he’s too busy for me and isn’t seeing what I do as a priority
– Why?: Because he’s
incompetenthas too many projects to handle effectively, and perhaps is lucky to be in his position– Why?: Because I haven’t started a revolution and rose to the top to take control myself
– Why?: Because vidya games
If you draw a
pentagrampentagon with equal sides around the outside of the earth and then draw 5 equal circles (as large as possible without overlapping) with the centre/origin of the circle being the angles of the pentagram. Then the largest circle you can draw within the middle of the earth inside the 5 circles is the diameter of the moon.I’mma need a diagram on your geometry here, I don’t get how you’re drawing your pentagram.
Why are you talking about a pentagram, I clearly said pentagon *whistles*
Right. So the circles are at the points of the pentagon. Got it.
@Saturday
Your mystery box has returned to my home!! Apparently where they tried to deliver the package it was refused by the person whom they were trying to deliver to ‘twice’. I’m not sure where the problem was but when I get home I’m going to have a look at the box and see where they tried to deliver to.
I also need to to dispense with the chocolate and biscuits somehow *looks at waist line fearfully*
THE MYSTERY NEVER ENDS
Thanks to everyone for the interesting topics this arvo. Helped pass the time, and it’s always really nice pushing your brain to think about new/different things.
Thinking is for squares! LOOOOOOOLZ
LOLZORZ XD XD
Seriously though I was reminiscing to a time when I was just a little boy, and remembering I thought I had in my mind about what sort of job I’d like to do after I finish school (I was bout 11 or 12 at the time).What a terrible thing for a young person to think for themselves. Learning is one of the wonders of our very precious existence and I hope people feel the same way about it as I do now, where knowledge is a gift that should be both treasured and shared.Conditioning’s a funny thing. I did a little teacher aide work in the 00s, and I remember taking one group of four kids aside to go over some maths stuff they were lagging behind on. Can’t remember if they were grade 5 or 6.
We nattered some, went over the working and some examples, then I let them at it. They had time to work on the questions, and when they were done, I asked to see the work so I could check it. The first one said, “Here, I’m finished… but I know it’s not right.”
I was pretty surprised. Arched an eyebrow and hesitated in taking the paper from the kid. I thought for a moment, and said, “What’re you giving that to me for? If you don’t think it’s right, take it back and do it again and give me something you DO think is right.”
ALL of the kids blinked in surprise at that.
Kid didn’t know what to do with herself, there. She took it back, looked it over, puzzled, and eventually decided that actually, she did think it was right. I checked it over and noted that actually yes, it was correct.
I’m guessing ‘I know it’s not right’ was meant to be some sort of ego-cushioning pre-emptive self-deprecation, setting themselves up to not lose face at failing. Maybe they only ‘knew’ it wasn’t right because they were the ‘dumb group’.
Gave ’em some mini-lecture about how I don’t want them to just pretend to understand, try and fail, or try on the spot to figure out how new numbers fit into the same pattern as the examples, I’d much rather they actually understand what the process was, how it worked, why it worked and if they could do that, they could put any numbers they liked in there. Even weird or long ones. …Didn’t get real far with that, but the teacher did note that she liked how the kids were a lot more persistent and resilient about admitting they didn’t understand something and asking for help.
Conditioning. Kids are very susceptible to it. Being made to believe they’re in the ‘dumb group’. Hell, even gender roles… When I taught the kids computer studies stuff? Distinct gender differences. Out of some three dozen kids, all the boys would leave their hands on the keyboard or mouse and some would even race ahead, thinking they already knew what the next step would be (and many were wrong). The girls? All would perform the requested action then look and wait for new instructions. And as many of the boys as raced ahead, the girls would put their hands in their laps, away from the keyboard and mouse.
Who teaches 10yr old kids these things?
All very interesting stuff, when I hear about things like these examples it makes me wish I studied Sociology at Uni 🙁
Gender roles are a tough one. They come from every thing that happen around you, how we were raised. And you can’t discard them, many of them are there for a reason. Having a tiny little daughter it is something that worries me a lot. I don’t want her to ever think she is inferior and “just a girl”. But on the other side many girly things are there because little girls love it. Seeing all the little girls dressed up and going to see the princesses at Disney on ice show that they truly do love that.
Yeah, it’s gotta be tough to analyze artificial or socialized roles to distinguish between the conscious social constructs implemented for control, vs the natural tendencies that spring from the very real and all-too-often underestimated differences in male:female physiology and psychology.
As long as no-one’s judging (no matter how well-meaning) a kid for their preferences or making it out to be ‘inferior’, you gotta hope it’s all gonna be OK…
The scary part isn’t even the judging, it is the expectation and thought process being formed in Tiglet’s growing mind. Buying a little kitchen set because she loves playing cook like Mummy and Daddy do in the kitchen is no issue. But the concept that if she is doing that then the kitchen is where she belongs are not far apart.
Trying to isolate and give the right message without stopping or putting down what she is enjoying sometimes freaks me out a little when I start over thinking it.
Have you heard of A Mighty Girl? http://www.amightygirl.com/
No I hadn’t but that is very cool
Probably not too important just yet but I think it will be something I reference as Tiglet gets older. Thanks
Finished ep 4 of Life is Strange and loved it. Possibly my favourite so far. There seems to be a bug on the PS4 where the rewind… uh… won’t stop. (When doing the L1 rewind.) Great ep, though!
*Weeps*
I had to reinstall all my games, and now it won’t run. I’ve tried re-reinstalling it, I’ve tried deleting the prefs, deleting the saves. I DON’T KNOW WHAT TO DO! *sobs for hours*
Aw man, really sorry to hear that. I know the frustration of losing save games for something like this. Not fun. :'(
I don’t mind the lost saves, I just wish I could open the game.
You restoring a backup or downloading the episodes again?
Reinstalled from scratch, twice. Verified game cache, made sure I disabled the cloud saves to make sure they weren’t interfering, tried launching both normal and safe mode, and IT HURTS SO MUCH. WHY DOES PC GAMING HAVE TO SUCK SOMETIMES?
Also, checked the forums, this happened to people when the first episode dropped, but the cause there was patched out, so I just don’t know anymore, and apparently throwing myself at it isn’t helping.
Need to try rebooting a few times because PCs are dumb and sometimes that helps.
The game was patched twice on the PS4 last week because the first patch busted some stuff. Ep 4 is also probably the buggiest one I’ve played, so I reckon there would be another patch impending. Might clear things up? I hope! :S Unless it’s your PC!
Yeah, I’ll give it until the weekend, since odds are whatever happens I’ll have to replay the whole lot. If it doesn’t work then then I’ll just cry for a few hours.
@blaghman: Does the PC version do cloud saves?
Yessum, I also made a manual backup since I decided to try fudging around with them.
Oh man, thanks for giving me a chance to whinge. God, I love whingeing. I can deal with anything so long as I get the chance to piss and moan about it. Feel so much better now.
Warning, warning! Personal details within. Just got some stuff I want to make public / talk about. Feel free to skip.
So for the last few months I’ve been under insane amounts of stress. What with taking a new job in management and adapting to that as well as the custody stuff that my partner has been going through affecting me as well, it’s not been an easy time for me lately. It’s gotten to the point where it’s affecting my physical as well as my mental health. I’ve been having regular migraines for the last few weeks, in addition to some severe mental breakdowns as well, which ultimately led to me going on stress leave 2 weeks ago.During my leave, the first week was ok but then some other personal stuff cropped up and led to me spending my second week of leave in a mental fog / darkness and pretty much unwilling to leave bed. This Sunday was the only time I felt capable of even leaving the house. Even going to work yesterday was a struggle to get out of bed, leading to a panic attack.
This has led me to where I’m at now. Yesterday I resigned from my position and stepped back in to my “old” role, effective immediately. That’s a stress I can control, since I can’t control the personal stresses. And after consultation with a doctor I trust (as opposed to the one I see for medical certificates) I’m going to start seeking treatment properly. It’s probably been a long time coming and I need help. So as of now I’m on the journey to find the right anti-anxiety/anti-depression medication for me as well as finding the right psychologist.
So, I know a lot of people on here are in similar boats with their own issues and troubles and whatnots. I’m a bit nervous, going on these medications and asking for help, which doesn’t come easy for me, but the support of others who have been there and are still there etc will probably help me in taking this first important step in getting my health right. Even admitting I’ve got issues is a help to me, since I can’t hide behind “everything will be ok”. Thanks for listening.
Dude, that’s rough. I really hope you can reach some sort of happy place. Not having had the same pressures applied to me, I can’t say I’ve been where you are. All I can say is, anything I can do to help you get here from there, you let me know.Thanks Red, appreciate the support. 🙂All the best buddy and well done on taking some positive steps to make things right. I’ve done a few stints on anti-depressants. It’s not always easy, but admitting my problems and starting to deal with them marked a clear turning point in getting my head right when I look back. I’m far from perfect, but better than I was by far! Also I’m really sorry you’re having a rough time. :'(Thanks, it’s not easy for me to admit things aren’t going well so I know I’m doing the right thing, I’m just a bit anxious about starting treatment. Which is I guess ironic in a way? Anti-anxiety treatment making me anxious? But I’m confident things will get better with time and treatments. First step on a long road.*Hugs*Finding somebody you can trust and asking for help is a good thing. It might not be meds, it might be but getting the right advice and having somebody who is interested in helping you get what you need is a huge things. Best of luck.*hugs* Talking to my “good” doctor was the right choice. She’s extremely committed to all her patients and genuinely cares about getting people well. Was able to discuss issues with her that I hadn’t even verbalised ever so that was an immediate positive step.That’s great you’re taking some logical steps to helping yourself with work and going to the doctor, you are definitely in control of those things. Someone whom I care deeply for is going through her own things in this space, one thing they tell me that helps is paying attention to the side effects of whatever is prescribed. There’s a whole family of drugs and they can keep mixing until you find one that helps without funny symptoms like rashes, eye aches, etc. I’m happy to hear that you’re on an upward curve, long that may continue 🙂Yeah the potential side effects of the medications I’ve been prescribed… well, I’m a bit nervous. I mean I know there’s side effect potential with most medications but the list of potential issues and things to be aware of has got me a little antsy. It’s going to be an interesting journey seeing how I react to this first set and then of course if that doesn’t work whatever the next one is. But have flagged with my doctor that I’m accepting of the fact that this may not be the right medication for me and we just need to keep trying until we find the one that is.That’s good! Most folks I know whom are taking something are usually on SSRI’s (Selective Serotonin Reuptake Inhibitors; They usually have names like Zoloft, Prozac, etc. and have maybe one or two side effects at the most. It’s highly unlikely you’ll get a raft of the side effects but usually just one or at most two, so don’t worry about that too much 🙂This is listed as an SNRI, so (Wikipedia tells me) it’s similar to an SSRI but also does stuff with norepinephrine. I have no idea what these things mean. :pIt’s just how the drug will work, if it’s an SNRI it just means that it will regulate your serotonin uptake (Serotonin is just neurotransmitter, sends info from your brain to other places and back again) so that you don’t make too much of it. The theory is an imbalance in this area can lead to problems with ADHD, Major Depression, OCD, and any other imbalances in personality, etc.*Takes off Exercise Physiologist hat*
Only slightly related: Depending on how your treatment gels with alcohol, we should totally consider some mid-week post-work unwind sessions at like… the Cobbler or something.I’ve been prescribed 2 medications. One of them is for daily use and should be ok with alcohol in moderation. The other is on an as-needs basis (i.e. having a particularly bad day) and is complete avoid. So as long as I’m not having a bad day Cobbler or otherwise should be ok.It’s tough admitting that you’re not coping, and well done you for getting some help. I hope the weight lifts soon.Thanks, I’m already feeling a little more positive just putting it out there (which I guess was the whole point) and I had a full night sleep (almost immediately after posting) which has been a long time coming, and I’m sure helped too. 🙂If you ever want to get out of the house and just hang without having to talk about anything in particular hit me up.
I’m sure I’ll want to in the near to immediate future, yes.
*hugs*
Casually trying to learn how to play Gin Rummy is quite an experience.
Fun game! Are you playing a simulator?
Yeah, playing it on my mobile phone.
Not gonna lie, Gin Rummy (specifically Oklahoma style) is one of my favourite card games.
So I don’t know how old these peppers I found in the fridge are (years possibly) and I don’t know how old these sausages are (also possibly years) and I probably left them sitting in the microwave after defrosting too long from being distracted (2 hours) so there’s a good chance I may die from food poisoning tonight.
This is why my wife shouldn’t leave me in charge at home for long stretches of time.
Did you make it?
Unfortunately I died early this morning. I’ll miss me. I was okay at times.
Here lies @freezespreston, his sausage let him down for the last time.
There’s leftovers so my sausage can continue to disappoint.
With that much sausage you could have a party of some sort.
OK, I just had the best assignment idea, and I need a place to write it down, and this is the only place currently available (I stopped mid shower to write this down, plus I can get feedback).
So the assignment is to create a swear word, a context and meaning, and an entire font for the word to be written in.
Context:
5 years in the future when teenage girls rule the linguistic trends because they make at least 5 new words a month as is (see turnt, thot, fleek, etc).
Must be bitchy. Must be something a teenage girl would say and use.
Word (feel free to suggest alternatives, though think teenage girl):
Becc’a
Meaning (feel free to suggest alternatives, though think teenage girl):
A dirty hoe that no one would ever sleep with, not even if they were desperate.
“you’re such a f*cking becc’a!”
“look at her. What a becc’a”
“She’s a hoe, but she’s no becc’a”
Font idea:
Font is made to look like it was hastily written in lipstick on a bathroom mirror to target a girl who is using a stall.
Becc’a reminds me too much of Britta’d. Way to Britta it, Liondrive.
Oooh, I didn’t really think of that…
I can change it to sound different.
I just like the idea is all.
First thought: If it’s coined by kids, it’s gotta be easy to text. A word with internal punctuation is not easy to text.
Second thought: have you ever been wronged by a girl called Rebecca?
Haha, no no, I was just thinking that teenage girls being the horrible people they are, would use another girls name as an insult, and thought that “Becc’a” sounded the most like a swear word was all 😛
A lot of newer swear words in Aussie culture already take from words that ‘sound’ like a swear word already, ie. thot, sloot, etc. We also like to shorten our words because we are lazy af 😉
I’m going to go with my suggestion as ‘Slu’ (Prounced Sl-Ah), short for slut, An individual of socially reprehensible sexual behaviour.
My other thought was “soho”, short for social media whore, if that’s any better.
I think it’s better. You should capitalise the S, because you know that anyone who uses this will want to evoke at least some of the arty hipster Soho Village vibe.
I love it!!!
More like snapslut
That’s a good one!
I’ll add it to my list that I’m brain storming 🙂
Thanks, Mama! 😀
che short for chat which is short for something else OR short for cheap
“Look at her shes so che
That assignment sounds mega crid.
Using a person’s name (even a bastardised version) as an insult is a bit too urban dictionary for my liking. Your soho for “social media whore” is more interesting but I’m curious if that fits the assignment? We have words like twatter for someone who’s a twat on twitter, or vaguebooker for people who post mysterious status updates for attention, but that’s more portmanteau-ing than creating. I like Soho, I think it’s original, but again, I wonder if it meets the criteria of your assignment.
I feel like your assignment (not that I have any basis for this) is to create a word that feels like a swearword, so even without context if you saw it scrawled next to your name in the context of “Stewie is a _____” you would feel offended, even though you’ve never seen that word before.
Does that make sense or have I overthought it?
Valid input, and I’ll definitely brainstorm more ideas and ask the lecturer, but from what I gathered the swear word just had to fit with the context you provide (mine being that it stems from teenage girls).
Only early planning, but all input is welcome 🙂
LIFE IS STRAAAAAAAAAAAAAAAAAAANGE (hi @strange)
Chapter Four
Best chapter yet.The prologue seemed to be a meaningless resolution to what ultimately ended up being a pointless cliffhanger, but it was so goddamned effective at grabbing me by the feelies and then just twisting them with every line of dialogue that I totally forgive it. Ended up being kind of foreshadowy anyway.I wasn’t especially surprised by the ending. I knew Mr Jefferson wasn’t all he seemed to be. This game should really be called Don’t Trust Adults.Seeing the Dark Room was terrifying.Will talk more tomorrow about choices, etc. @dc
So.
I feel like DontNod have been following all my posts about this game in the last couple of weeks, and have just retroactively applied it to the game. I remember commenting that with the first Frank encounter in the junkyard in Ch 2, that Max’s power could have been used to find him and evade/ambush him.And now, with this Frank encounter, they’ve given me the chance to go back and radically change the outcome based on knowledge of what will happen. That whole scene was brilliant. The first time around, Chloe shot the dog and Frank, so I made her ditch the gun and asked Frank to close the door. This time around, Chloe stabbed him in the leg, but we got the information we wanted. Hmm…. I think I can do better. So I paid Frank off with the ‘disability fund’ money (damn, turns out that was a real thing) and sucked up to him and now we’re all besties looking for Rachel.Honoured Chloe’s wishes in the prologue. I never thought a game would ask me what I thought about euthanasia and put that belief into practice, but there you have it. But like I said last night, the whole thing seemed a little pointless. If Max’s ability to photo-travel doesn’t factor into the finale, it will have been one emotionally-exploitative story red herring. That said, it was extraordinarily good at exploiting those emotions.Every time I break into a room or a locker or get a password wrong or something, I always rewind time to erase any sign of my meddling. So far it doesn’t seem to have made a difference (except possibly when I found the surveillance equipment in David’s garage), but I hold out hope.Max in my game is a goddamned rock star. Everybody loves the hell out of her. She has literally no enemies except for Nathan. I let Warren pound him, BTW. Little fucker totally deserved it, especially given what I know now. And it’s good, I think, that he was actually rendered powerless for once. It probably won’t make him stop and think next time he feels the entitled asshole coming on… but it might.Max has let this fame thing go to her head though. She spent the entire chapter telling everyone how awesome they all were. That’s part of teenage life I never experienced when I was their age. Must be a girl thing.Can’t wait to see how this all ends. Roll on September.I’m still in Episode one, I can’t read these dayyummm spoilers!
Yeah, definitely don’t read them.
Hngghh… Must avoid spoilers for 2 weeks
Yeah, I absolutely loved this ep. Easily my favourite so far. I didn’t think the prologue was meaningless. It didn’t advance the story but it gave Max a terrifying reality check about her power that I thought resonated through the rest of the episode. (And the rest of the series, I’d wager.) From that moment on I’d hesitate every time I was going to rewind something. Had like a weight to it that wasn’t there to that extent before. But you’re right, that opening messed me up real bad. I felt like I wanted to leave and I couldn’t handle the gravity of the situation, but I also wanted to be a good friend. I think it put me in Max’s shoes brilliantly.
I felt overwhelming joy seeing Chloe again in the proper timeline. Really well done.
I loved the sense of momentum through the rest of the episode. Doing the leg work. It was great to see Kate again and I really didn’t expect we would to that extent. I can’t help but wonder what happened in that scene if Kate was dead. I thought the new locations in this game were brilliantly realized too. That beach in particular was just a thing of beauty and I enjoyed seeing all the outcomes of Frank and Chloe’s encounter.
My choices:
I didn’t honor Chloe’s wish in the opening. I felt like Max was going to fix this, even at the expense of William. Every encounter with William made me feel so damn guilty as well. XD
The rewind after the meddling? That’s exactly what I do too! It did have an effect in the first episode when you covered your tracks after snooping through David’s files! Major one I fixed in this episode was undoing the damage to Nathan’s dorm room door!
I managed to survive the encounter with Frank with no one getting hurt. They even seem like allies now which is weird, after the first version resulted in murder. 😛 YOU STOLE THE DISABILITY FUND?
Still flirting with Warren every chance I get. Changed that message on his wall. I also stopped him from beating up Nathan, cause I felt like it could have bad repercussions for our pal.
I also warned Victoria and she believed me!
The whole Dark Room thing gave me The Girl With the Dragon Tattoo vibes!
The only thing that annoyed me in this ep was making me confront Nathan and not letting me avoid it. There was another exit on the floor, for one. Why not let me use it? I rationalized it in my head that Max was gun shy with her power now, but felt a bit off.
Fun fact: I tried the non-euthanasia option afterwards just to see how different it was, and afterwards, Max just sat there and wouldn’t respond to any button presses. SO CLEARLY THAT WAS THE WRONG DECISION.It was always pretty clear that Max would be returning to her timeline. That whole opening part of the game made me sad. That family was doomed to heartache and misery, no matter what Max did. That’s some destiny right there.Man, that opening hit me hard. I wasn’t expecting it to be that intense at all. Had to put the controller down quite a few times and said “Fuck this game” out loud.Yes, I stole the disability fund. As Max says, there’s no way it was legit. Cash in a desk drawer? No way that’s a real thing. Don’t I feel like an asshole now! (though I think the writing needs to take some of the blame here)I fixed the door, too! I loved that Max commented on it as soon as I did that. Amazing detail. While we’re talking about detail, did you see the bottles at the party? Max’s comment: “No. More. Bottles.” BRILLIANT throwback to the shortcomings of earlier chapters. I might have fist-pumped.I am steadfastly rejecting Warren every chance I get. I thought about writing on the board to confuse him, but rewound it mainly because that CU.TE. joke was just awful.Nathan was MAD either way. I figured having the shit beaten out of him might make him less physically able in any final confrontation. Also, Warren feels ‘alpha’ now. Thanks, Warren.I hate to tell you Shane, but there’s disability construction works going on in my episode. Was legit. 😛Yeah, the sign said “postponed indefinitely” in mine. WHO PAYS CASH FOR THAT, THOUGH?I fixed Nathan’s door, too! I loved that Max commented on it as soon as I did that. Amazing detail. While we’re talking about detail, did you see the bottles at the party? Max’s comment: “No. More. Bottles.” BRILLIANT throwback to the shortcomings of earlier chapters. I might have fist-pumped.I think almost certainly the money was a bribe, but yeah, Principal was actually putting it to use. I like the little recurring jokes too, like saving Alyssa. So fun. Oh man, that bottle thing I felt was the major misstep of the series, so like you said, good to acknowledge it. 😀 I really love how fleshed out Arcadia Bay feels now and you know where you are based on where you’ve been before. Loved the ominous new main menus after the episode with the impending storm!Edit:
I love the small details too like Max’s diary being different in alternate timeline and a glimpse at who this Max is through the text messages. Nice touch!OH!
I loved the alternate universe text messages! Phenomenal attention to detail.Was really disconcerting that a day had passed when she went back to her own timeline though that she was a part of but had no memories of. That would keep me awake at night! 😛I don’t think all that much time passed. Just a few hours. But yeah, enough to unnerve, for sure! Chloe made a joke about Max “getting one kiss and then being all over her” when Max returned to the present. I love all the little impacts of Max’s decisions – gives it real authenticity.Oh that’s awesome! Chloe was all like: “You didn’t kiss me before, why you all over me now?” Great little touches of detail!@dc You were totally right about this game. Our friendship survives another day.
Haha! I wasn’t sure after the reaction of the first episode, but I feel like even with that we ended up on the same wave length eventually. <3 <3 <3
@dc To be fair, the dialogue was awful in the first episode, and that was my primary critique of it. Every episode since then has improved the quality of the dialogue insanely.
While we’re on it, the “I don’t like the word ‘hella’” moment in the alternate reality was my first clue that things were going to be hurting my feels. How could they change my disdain for that word into an emotional response to its absence? THE MONSTERS.Oh yeah! What a moment! :'(
I still think the creepy grounds keeper guy isn’t written particularly well, but otherwise the writing has been pretty good. 🙂
You’d have to be a special kind of monster not to warn Victoria. In some ways, I can’t believe that’s even an option in the game. She believed me too, by the way… because of a choice I’d made in Chapter One. The five-day timeframe was a risky design move for them, because it introduces variables that would fade into obsolescence with a longer timeframe, but I think they’ve done a great job of making the characters remember everything that’s happened.Tagging you here @sughly, in case you want to ramble about the episode with pals after you’re done! Don’t look before hand! 🙂
Edit: replied to wrong DC comment. Whoops.
Haha, I finally got around to playing it! I think I am less enthusiastic about it than you guys after having a quick read though.
I’m glad the time jump was temporary, really wasnt a fan. Like Ive said before, its spent all this time developing characters in a particular way, its just losing all that development. But even being temporary it weirdly did enough to take the momentum away for me, which is why it took me so long to play. But, a lot of this chapter is just reacting to warlier choices, and because I’ve so meticulously been the good guy everything was just praise for me. It felt kind of shallow, like it was a chapter about how great Max is and how great Max thinks everyone else is too. I kind of disagree about the writing, I feel like it’s gotten more obvious and melodramatic, I mean stuff like Frank suddenly being all ‘yeah I believe in you guys!’ is so out of place. Really dont think this was the best chapter at all, Kate’s near suicide and the events leading up to is probably that for me still.Oh where was this blue jay the game said I killed? I didn’t see it at all! This is the second time I’ve killed a bird by not observing properly! XD AND A PLANT!You really didn’t see it? In mine, as soon as Max walked out of the room, it flew past her head and she said “Oh! That bird is still trapped in here!” Must have been something different in yours because Max has a blatant disregard for aviary lifeforms.Oh, I rescued the bird before I changed the timeline? Maybe it wasn’t in mine! Definitely didn’t hear that dialogue, though. :S I’m sure I wouldn’t have missed that, but I’ll replay to see. Maybe I was too busy processing my feels. 😛 Oh wait! If the first bird was dead, it was probably that one again.From memory (which is quite likely wrong and clouded by manly emotion) I think it was as soon as Max returned to the ‘real’ present and left Chloe’s room. It flew past her head and into the bathroom, and then I had to scare it out the window.Re: your edit
Oh yep, that could be true.It was clear why the game was delayed too. Longest episode so far and lots of new environments. I’d say that’s worth waiting a week for! 🙂
I work in an area where we aim to release a publication about every three months. One of the most common responses we send out to stakeholders is that “Our report has no set release date. We aim to publish around every three months.”
My point, I suppose, is that I don’t consider this chapter’s release to have been delayed because it didn’t have a firm date to begin with!
Either way, though, agreed: totally worth the wait.
Waaaaaagggghhhh, so many moments in this episode to remember and talk about!
@dc, we haven’t even talked about
Chloe being shot in the head by the photography teacher!I feel like the whole point of the euthanasia scene at the start of the chapter was emotional preparatory work for this moment (I’m assuming of course, the same thing happened in yours).Same thing happened in mine! Oh man, that moment didn’t register at first. Took a couple of seconds to sink in. The game’s been sort of Final Destination-y with Chloe. She just keeps on dying. The train tracks, the bathroom, the alternate universe. I really hope there’s a way to save her. That reveal of Mr. Jefferson instantly made me remember the rumours from the first episode that he was sleeping with Rachel Amber too.Sadly, I think this one will probably stick.IDEA!I think I know why they introduced the photo-to-the-past mechanic in Ch 3!Maybe Max will be given a choice to go back into a photo and revive Chloe, though risk tearing the fabric of the universe asunder (or sacrificing someone else) in the process. Or maybe she’ll go into one of the early Dark Room photos and save Rachel. So many possibilities!Yeah, I thought about the possibility of ‘undoing’ the entire game too. It would be conflicting, because none of this would have happened… but it would need to have happened for it to not happen. *head explodes* You think the two moons and eclipse were a result of two universes colliding? (If NASA in our world can’t explain the eclipse, maybe NASA in another world could have. :P) Bring on September!I did read that season two would be an entirely new story with an entirely new cast, so finale could diverge in lots of interesting ways without having to refocus for season two!
Can’t wait to find out!I forgot about David, too! He seems to be pretty on top of what seems to be happening around here! Oh man, my Max has treated him so badly. I’m gonna feel so guilty if he turns out to be a Snape.My Max has kind of been going easy on him for Joyce’s sake and I feel like that’s paid off a little. He’s not openly hostile to me any more and vice versa. The more I think about it, the more I like the idea of stopping Rachel from being murdered and meeting characters at different times in their lives. Seeing Rachel and Chloe interact. Whatever they want to do, though, I’m on board! 🙂 I am psyched to see the storm as well!I wonder what would have happened if Chloe didn’t have a gun! I think there’s probably a path through the game where she wouldn’t have one at this stage.My impression is that she was shot because she raised the weapon.Even though she probably would’ve been shot anyway, I really love how this game presents the (probable) illusion of multiple pathways! It’s, IMO, much better at it than Telltale.Yeah, maybe Frank would have given it back to you when you became allies?Definitely way more Quantic Dream-like than Telltale. I know it’s a big call, but for me this is personally my favourite episodic game. Feels less manipulative than The Walking Dead too. 😛
But that’s not a foregone conclusion either.If Frank takes her gun in Episode 2, and then Chloe stabs him in Episode 4 to prevent an alliance, and then we pull Warren off Nathan so she can’t grab his gun, she’d probably be unarmed in the Ch 4 finale (unless she retrieves the gun from Frank either way in Ch 4).Yeah, it’s pretty intriguing and I almost don’t even want to know alternate outcomes. I love the idea that this is my story and it’s different from everyone elses even if it’s an illusion. 😀
Oh, me neither. If this is a branching choice, I’ll own it. I just love that it creates the potential for ‘what-if’ discussions, because the points of divergence aren’t always clear. *makes notes furiously for game design*@shane: The game has done an amazing job of using the ensemble too. I feel like I’ve known these characters for months now. (When in reality the game has spanned just under a week!)
I invented a fun new game. Click on the spoiler tag, scroll before any spoilery words pop out at you.
I know, I like to live life on the edge.
I was wondering what larger effect the ‘prologue’ would have on the rest of the episode. I thought it might be ultimately to show Max that what she thought was a good decision at the time could come home to roost in the most horrible of ways. Also to foreshadow a decision she might have to make in Episode 5 about saving Chloe or not from Mr Jefferson.I don’t think she’ll be able to go back into photographs that she herself isn’t in, because otherwise she could go and save Rachel and Kate, for example, but the photo that Warren took with her came off as just a little too clumsily written into the story for it to be anything other than an opportunity for her to go back and save Chloe. I’m thinking that she’ll be rescued by either David or Warren, but it’s a possibility that it could be a ‘group’ rescue made, with all the people at the Vortex party that Max was nice to helping out in some way (that would be cool).The Square servers were down when I finished the episode so I don’t know the percentages for choices, but my choices were:1. Put Chloe to sleep;2. Convince Frank nicely (I kind of regret giving him the cash though);
3. Nathan gets beaten very badly;
4. Warn Victoria (this has got to be relevant somehow… but how!?)
DECISION BUDDIES!
So I’ve got a weeks holiday coming up. Where do I go?
Melbourne or Adelaide ? (Perth and Darwin were too expensive)
http://www.flightcentre.com.au/holidays/fiji/3749596
Too expensive 🙁
At this stage we might just do a roadtrip around NSW
Melbz!
Anton seems more interested in adelaide, but also in terms of expense we are now thinking a road trip around NSW.
Well, if you come to Adelaide I’m more than happy to host the two of you for board games.
Depends what you want to do. If you come to Adelaide, I wouldn’t advise spending every day in the city, but if you hire a car you’re less than 90 minutes drive from 3 distinct wine regions and pretty close also to the coorong, probably as an overnight trip.
Depends what you want to do really.
I liked Adelaide, would love to visit Hahndorf again.
I’d suggest bali, but there appears to be a volcano happening. So I second Fiji. A week of sitting on the beach doing NOTHING sounds delightful.
Hoi, chummer. Shadowrun Hong Kong and Satellite Reign both due late August.
*cyberpunk dance*
EDIT: Cute. autocorrect thinks ‘Hoi’ is a spelling mistake.
I think I own like four copies of Shadowrun HK thanks to having way too much disposable income when the KS happened…
Still haven’t finished Shadowrun Returns, or opened Dragonfall…
Finished SRR twice, but still have yet to do Dragonfall. SRR was fantastic, with some minor quibbles, and apparently Dragonfall was even better. Need to pull my finger out and play it through.
Yeah, I totally screwed up my character, so I’m thinking I should restart and go for some min/maxing.
If you can’t take out an entire army by yourself you’re not running properly.
Also if your entire squad isn’t losing to a single average enemy. That’s an integral part.
Blaghs the master strategist.*
*Further reading: his exploits in Total War.
My Shadowrun group failed to kill a dude who was the cyberpunk equivalent of a rat once. We made up for it by killing a troll later, but it was wonderfully pathetic.
(Side note: Last night in Total War was really boring, so I’m sad. I fought one army(THE FRENCH!), won one sea battle, and now I just have a Spanish army sitting outside Paris, watching, waiting. Not enough for me to spin into a story of my ineptitude, which is immeasurably disappointing.)
New levels of disappointment! Blags doesn’t disappoint at disppointing. 🙂
Don’t min/max, make what you want. With the NPCs available you can get a working party easy as.
But min/max is what I want!
You could try making a guy who basically shouts “Yay, I’m the hero!” at the end of every fight. So essentially, a Decker or Sniper 😛
In SR:R I went with a melee / whatever those melee Magic abilities are called character
In SR:D I went a long range rifle using decker (or whatever the one that can hack is called).
In both games I never had too much trouble with fights.
I played as an Elf Street Samurai focusing on pistols and defence. Midway through the game I essentially became an agent from The Matrix.
I had no disposable income for the KS, and was really tempted by all the different optional stuff. Nearly went with the bag despite knowing the quality probably won’t be great.
Yeah I eyed off that bag (and the KS) for a while too, but came to the same conclusion. Also kinda broke at the time. Just ended up buying SR:HK when it popped up on Steam.
I managed to play a little bit of SSR in the last week. Hopefully I’ll be able to finish it and then get onto the copy of Dragonfall that the ever dreamy @freezespreston gave me
Ill take a copy even though I too having even started SRR
So hype for SR:HK
I became a massive fan of Shadowrun with Returns. I still think the best aspect of the universe is the slang. So damned good!
I’m looking forward to pumping up my stats so my to hit chance is 97% then missing over half my shots.
Damn thats a strong 3% do your characters copy over or what?
Good Morning All,
Longtime reader but first time poster to TAY 🙂
How are we all doing?
Pretty good, bud. Pretty good. And you? Want some rye? Course ya do!
I am doing great and I would love some rye! Thanks for your kindness DC 🙂
Hello!
Nice to see a new face around 🙂
I’m pretty good, thanks!
Hope you’re well too 🙂
Don’t be afraid to jump in to any random conversation 🙂
Hello Liondrive,
It’s great to hear you are good, I am doing pretty damn fine for a wed, I am basking in the warm welcome I am receiving, I should have done this a long time ago 🙂
Will happily jump into random conversation when I am sure I have something reasonable to contribute. Perhaps even if I don’t 🙂
Looking forward to more TAY chats! I hope you have a great day!
Welcome aboard!
Once you’ve participated in your initiation, you’ll be one of us. (one of us….)
Thank you Shane!
I appreciate the welcome and I will be sure to checkout your novels sometime 🙂 And I know that’s a quote there but for the life of me I can’t place it (and my google search didn’t satisfy my curiousity either). Feel free to enlighten me when you can!
http://movies.stackexchange.com/questions/24068/where-does-the-one-of-us-one-of-us-chant-originate
Thank you sir! 🙂
Welcome to TAY!
Thank you kindly! 🙂
Heehee, I giggled at your name. 😛
Welcome!
How are YOU doing?
Ha ha, thank you Strange! If my name lifts people spirits then that makes me happy 🙂
I am doing great thanks, just happy to finally take part finally in the awesome community here. I am looking forward to getting to know you all 🙂
Oh hello new person! I’m well, yourself?
Greetings!
I am doing well thanks. How are you on this fine friday eve?
Pow! Pants! Housewarming!
Who: You
What: House. Warming.
When: This Saturday 1st August, starting at 2pm and going until we get sick of you.
Where: Our flat (Twitter DM/email me or Pants if you need to know the address)
Why: Why not!
Just gonna be some time to play some vidja and possibly board games. Snacks! Drinks! Other!
Want to stay overnight? You’re welcome to! Just let us know ahead of time. I’ve got a couple of blow-up beds and there’s plenty of lounge space (seriously we have way too many lounges).
@35 @alexpants @anonymous_pessimist @batguy @cakesmith @cj @cookingmama @dkzeitgeist @doc_what @fatshadylive @gingerchris86 @gorzilla @hugo_the_hungarian_barbarian @mawt @morkai @mrtaco @novacascade @pupp3tmast3r @ruffleberg @shiggyninty @blaghman @freezespreston
Wait, you tagged Freeze? Guess I better step up to the plate.
*ahem*
OH I SEE HOW IT IS. FINE, I DIDN’T EVEN WANT TO COME.
I can’t win!
Now you get it.
What’s the Other! exactly? It may influence my decision.
Whatever your heart desires.
I’m there.
Availability pending. What area are you guys in now, was it north shore?
Yep, Artarmon.
Massive flashbacks… Lived there for a few years and worked there for several more.
PS – best crispy chicken noodle soup in all of Sydney is in Chatswood. A little shop on bottom floor of Lemongrove. Assuming it’s still there, goto ground/underground floor from the mall, follow shops around to the left and it’s tucked in the corner.
Used to go there once or twice a week for lunch when I worked on the mall.
Oops! Reply Fail 🙂
I think I was going to say here that Chatswood has changed so much since we lived here, but that the food court in the Mandarin Centre is still awesome.
More like, Fart-armon.
HEYO!
YOU TAKE THAT BACK
good chance I’m gonna be freezing certain extremities off in the blue mountains this weekend, so I dont think I’ll be able to make it.
I’m working that night but I’ll drop by for a bit
Groovy.
I can’t remember the last time I dreamt about being a ninja turtle but apparently this morning was ripe for a throwback.
NFI why on earth that would even be, haven’t had any reason to even think of them in ages. Stupid retardo brain.
Bossa Nova?
Chevy nova?
I really need to give that movie a watch again now I’m old enough to understand half of what’s going on. Had to google to figure out what you were talking about 😛EXCELLENT
“I… have always liked… COWABUNGA! Hahahahaha, I made a funny!”
Hot damn, I love that movie. It’s such a massive part of my childhood.
I remember being blown away by it being on a green VHS cassette.
@redartifice I got my hands on the Cypher System Rulebook last night and it’s basically taking a whole bunch of stuff and lessons from Numenera and The Strange. There are four main character types now: Warrior, Adept, Explorer, and Talker? (can’t remember the exact name of the last one). So basically you have standard fighter, mage, rogue but now there is a bard mixed in as well.
Generic cypher generation, regardless of setting, works pretty well and they have some good things to help facilitate the game. For instance, currency is now completely generalised into different tiers of wealth rather than counting individual dollars or shins which, considering that the CSR has to cater to a whole range of different settings, makes sense. There is also basically a master list of all of the better descriptors and foci that they’ve changed to be mostly setting agnostic so that’s pretty cool.
Is it worth it? I haven’t gotten the physical book yet (crosses fingers for soon) but it does retread a lot of stuff that’s already been published by MCG so your kilometerage may vary. I didn’t shell out for the leather-bound super fancy edition because that was very expensive.
Sounds cool, but I haven’t picked it up. I think it’d be a pretty easy hack to put into other settings, but it’s the setting that inspired me for Numenera.
I still have the dl link for Worlds Numberless and Strange sitting on my email, must have a look at that.
I agree that the settings for both Numenera and Strange are pretty darn cool but I understand the appeal in having a dedicated high fantasy or other setting Cypher game. Plus having a bunch of the foci and descriptors all in one place is pretty nice as well as bringing in the talky type rather than trying to house rule the Spinner from the Strange.
Oh, I think it’s work well as a system for running lots of games, I just tend to respond to fluff over crunch.
I’m in a mixed boat myself. I appreciate crunch and fluff in equal measure and the buy-in to the setting for Numenera or The Strange is no worse than the buy-in for stuff like Shadowrun.
So the Dragon Quest games are like Final Fantasy games as in they’re unrelated right? Always wanted to play them but never got around to it. So I can just grab XI and start there with no problems?
In the past they were related in small bunches, but I think they’re separate now?
Yeah. Totally separate. I’ve only played IX and really liked it
The best most unrelated Dragon Quest game is DQ Heroes: Rocket Slime on DS.
Especially if you like page 6.
I’ll probably get back into Dragon Quest if I ever get a PS4. I think there’s a port of DQVIII coming that I’m keen to play because I got like 90% of the way through on PS2 and never finished it.
As it happens I have IV, V, VI and IX for DS and don’t want them…
Oh I just remembered.
I still have a beta code for
The Division (comes with preorder DLC gear for the actual game)andtwoone for Rainbow Six Siege if anyone wants them.They’re for all platforms (X1,PS4 and PC).
*waves*
OOOOOH!
Which one?
The Division would be rad. I have high hopes for that game.
I haven’t actually paid much attention to Siege. How does it compare to older RS games?
DM’d it to you.
I have no idea about R6S. Never paid any attention to it. One of the EB guys just popped over with a stack of beta codes and said here you go. Shooters generally aren’t really my thing so I gave them all away without keeping one for me.
Cheers!
I have low hopes for RSS. Multiplayer, small maps, rapid planning phase.
I have very low hope of it being anything but a run and gun session and horrible to play unless you get proper teams organised
If im not late aiege please ps4
DM’d.
Dammit I missed the giveaway! @rize tell us your impressions of the Division when you give it a play!
Will do!
I’m reading all this stuff about the Ouya acquisition, and I have to ask: For those of you that bought them, did it get any use?
I’actually love to see this question get some attention on Kotaku to get a bigger response. Curious to see how many people did anything with it beyond the first few months of ownership.
I went to school with the guy that started the ‘Coning’ craze where he went around and went to a bunch of McDonalds and started doing crazy things with the 50 cent cone. He was one of the first people to receive a Ouya, I asked him what I thought about it:
I got one from backing the Kickstarter, but much like most people I got it and then just kind of wondered what to do. I was hoping to pretty much make it a dedicated emulator box for the TV in my lounge – purely for SNES games. But there were a couple of complaints from me:
Controller:
-Massive input lag (about 0.5sec?), especially noticable on emulators. Made platformers literally impossible to play
-D-pad was just horrific. Boaty/floaty and really hard to perform any precise movements
The unit itself was solid, but came out with an already dated Nvidia Tegra chip (2 or 3?) forget which. So performance was…. OK. It was meant to have a bunch of games made especially for it, which it did end up with a few, but there was nothing there I couldn’t really already get on my phone. It had a bunch of emulators, and they worked really well, but the input lag and terrible d-pad made it unusable for emulation.
So it ended up failing as an emulator because of the controller, and the rest of it was just entirely unremarkable. A shame, because with a hardware revision of the controller, and a new Tegra CPU and just a little more support, it could go places. But even then, it’d really only be for the gadget inclined. I can’t see it ending up in the everyman’s loungeroom.
I loved the idea of one as a dedicated emulator but when I started hearing about all the troubles people were having I realised that I dodged a bullet.
Would have been amazing if it worked. I spent a lot of time running SNES and GBA emulations between like 2000 and 2008…like…like a lot of time. Pretty sure I was averaging 4 hours of sleep a night those days 😛
Xperia phones run emulators, natively support DualShock 4’s and can screen mirror to smart TV’s.
All good Android phones can screen mirror these days, but going Sony only (phone, TV, controller) does make it way easier. Next to no fiddling.
I don’t have a PS4/controller but I did set a Wiimote on my tablet (these days the TV is hard to get a hold of…) which worked wonders, especially considering the age and brand of the tablet involved…(4+ year old HP)
The controller looked like it should have seen them prosecuted for war crimes.
Strangely enough, apart from the d-pad, the rest of the controller was pretty well made, considering how cheap the whole package was. Analogs were decent, controller felt nice in the hand, good weight – but that d-pad. Ergh.
Totally missed the post from @sircoffeegus outing himself as a TAY
stalkernewbie.Welcome!
Oar, etc. obligatory donation of food to @bish.
Greetings Rize! Is it still considered stalking once you are aware of it? 😛
I can also out myself a big SW fan too (nice profile pic!). Though I promise to try to keep my heavy breathing to a minimum 🙂
So I just tried searching for those snowboard boots I picked up to see how much of a steal they were.
Ended up finding an “interesting” 404 page.
I’m shattered I get the reference. I looked at goatse once almost twenty years ago. The image is still seared into my memory. For all time, methinks.
I think I’ve managed to avoid ever actually seeing it. I mean, I’ve seen thousands of references, visual representations and the like, but unless my memory has wiped actually seeing it (entirely possible) I think I’m clear.
http://i.imgur.com/WLpoapO.gif
Twitter has locked my account & demands my mobile number.
This is bullshit
Aw, how’d that happen? Reported? Hacked?
I really dunno :-/
Interesting. Wonder if this is their way of finally trying to combat the problems they’re having. Be much harder to duck a account ban if you need a new phone number everytime.
Life… finds a way.
Hold on to yer butts!
I was able to immediately delete it from my account once I had access again.
So no.
Personal information? WAZAT?!
Far warning: political discussion ahead.
Regarding the Bernardi vs Wong debate that just wrapped up, what’s a (serious) question you’d have loved to hear an answer to?
I think mine would be “Assuming the slippery slope argument is unequivocally proven incorrect, can you please describe the negative ramifications of marriage equality?”
Here is a serious answer to your question: https://www.youtube.com/watch?v=O3ZOKDmorj0
I’m at work and could only follow the twitter feed – did Bernardi just get as badly annihilated as it seems?
I don’t think there’s any more “good” questions for Bernardi, they’re just prompts for him to repeat old arguments. So, like your question, they just work to continue to expose his bigotry.
From what I read, Wong deflected his question of potential ramifications for businesses who refuse to provide services to SSM. I’d like to press Wong on that, or why she she doesn’t suppory polygamy – both questions provide a bit of room for intelligent discussion.
It was pretty clear that the audience in the press club were leaning towards Wong, as they applauded her responses with regularity.
That said, I don’t think any of the arguments put forward by either politician will actually change anybody’s mind on the issue. Debates like this are fluff pieces.
Yeah, I agree. Funny thing about a selection of Australians in a room together supporting marriage equality, who would’ve thought it has such wide support? /s
Ramifications for business? They won’t get a share of profits in a new market willing to spend big and if they fall by the wayside because if that they have no one but themselves to blame.
The point Bernardi was making, AFAIK, was that they could face lawsuits for discrimination. Although I believe there shouldn’t be any protection against that, the simple fact is that there is a small minority of the population that will not change their views and either risk those lawsuits or stop doing business and that is a point that deserves some discussion at least.
My question to people who make this point: Would you support a business discriminating on the basis of race?
What lawsuits? Businesses can refuse service to whomever they like. Rights as a customer only apply when you’re actually a customer. Only way someone could sue is if they took their money then refused and only if they didn’t give the money back.
My understanding as well.
There’s a stink on my Facebook feed at the moment about a restaurant forbidding families with kids under seven from entering. Not breaching any laws AFAIK, but definitely incurring public wrath.
Wong actually said that the market would sort it out.
“Do you think gay people are deviant?”
Might as well get that elephant out of the corner and onto the table. Also, I’m sick of journalists asking ‘clever’ leading questions, trying to guide the discussion. This is the only question that needed asking the entire debate, and no one asked it.
Haha, and get a reply along the lines of “No, but yes”. Just a more eloquent version of the classic ‘strayn “Nah, Yeah”, or “Yeah, Nah”.
I’d ask Bernardi to marry me. repeatedly. forever. I’d offer him sex acts his wife could never even dream of.
I’d just be curious to hear his answer.
My question is to Cory Bernardi “Are you aware that Gay Marriage isn’t Halal? Does that change your position on it?”
RANDOM QUESTION TIME.
what dead videogame franchise needs a new installment?
My pick is Kingdoms of Amalur. first one was rough, but had so much potential. really think a sequel would’ve been amazing.
Gabriel Knight! If they need to modernize it, then I’d be okay with them doing it in the style of Heavy Rain or Life is Strange!
You forgot to mention Beyond Good And Evil. I am disappoint.
I’ve accepted it’s over and that’s okay. 😀
Wasn’t there a Beyond Good & Evil 2 video bouncing around the e3 just gone?
Michel Ancel has said he’s not working on it any more.
I would still like to see The Force Unleashed III.
Or X-Wing Vs. Tie Fighter 2.
If I think of a non-Star Wars example, I’ll edit.
Did you know the original creator of the X-wing series of games are making a new game trying to recapture the feeling of the old series, Unfortunately without the Star Wars name?
Starfighter Inc.
Actually looks pretty good so far
I’ve heard of it. It’s multiplayer, though, right? Not my bag.
(I know I said XvT, which was marketed as MP, but I played that game religiously SP, and flew customised missions when I got sick of the core content)
They said initially multiplayer but he would love to do large story driven Co op missions, so I suspect there’ll be a single player component to it… At least I hope 😛
I’m good with it if it’s AI co-op! Will keep an eye on it – thanks, man!
Wait, that’s going ahead? I thought it failed its Kickstarter…
IIRC it launched its Kickstarter again immediately and hit its target within two days…
Warning: it is not the creator of the X-Wing games. That’s Larry Holland and he’s not involved. It’s a guy that worked on them, but not the creator.
It’s also multiplayer-only so NFI how it’s going to recapture the feeling of the old games aside from XvT.
I guess now they’ve been disowned those are non-Star Wars examples.
Slight bastardisation of the question, but I’d love to see a return to form game from Rare, preferably on the Wii U but I’ll take a 3DS one.
Does Yooka Laylee count? Especially since its the original Rare team making it?
Kind of, but I can’t seem to shake the feeling that it’s going to feel like a cheap knock-off…despite being made by the same people.
Yeah. I backed it and I’m looking forward to it but a lot of it feels like a fan game that got a takedown notice and decided to salvage it’s work by replacing the character models and renaming everything. I think it’s going to take me an hour or two of playing before I’ll be able to get past the fact that it’s more or less Ultra Blario Cousins.
I just wish Rare had of responded to Nuts & Bolts performance by taking the engine and making a smaller, proper Banjo game. I mean in terms of the engine it was pretty much all there. If there was a PC version I’m sure someone would have modded it into a traditional Banjo game by now.
Wonderboy.
I remember I played one of the Wonder Boy games on the Master System (it was a weekend rental) and I didn’t get far into it because I was an idiot and couldn’t figure out the run button so I got stuck on a jump on like the second level. Up until then I’d really been enjoying it. Screw a reboot, I want to go play the old ones now that I’m not a complete moron.
On that note I’d like to see another Maximo game.
The Neophyte RPG series from Alien Software in the late 90s that never got completed. 3 episodes / demos were released and very promising, but ultimately never made it over the line. In the era of Kickstarter and whatnot though they’d have a shot, I reckon.
Here’s a fun story about old video games and what happens to them when people start wanting the rights to bring them back from the dead.
http://kotaku.com/the-sad-story-behind-a-dead-pc-game-that-cant-come-back-1688358811
You and me need to have a talk about what constitutes “fun”
Stunt Race FX, using the claymation style they did with Kirby.
Also, Unirally.
Also also, Space Station Silicon Valley.
Oh hells yeah.
NOLF. God I miss Cate Archer, and the poignant henchman monologues.
See my link to Bob up there.
I. Know.
God help me, I know. *twitch*
“yes sir! I mean erh no sir… Erh, I mean yes to the first part and no to the second part, sir!”
“I’m sure it’s a perfectly excellent monkey, but I don’t want it. Now please leave, I’m very busy.”
Legacy of Kain! Need more Nosgoth! That’s not some barstardised multiplayer dealy
I want another Soul Reaver. Couldn’t get into the non Raziel stuff (though I never played the original).
Raziel is the best! That voice!
XIII.
Fucking cliffhangers.
Yes! I loved that game so much. Don’t think there’s been another game in its style yet has there?
Not to my knowledge. Not a comic book proper cel shaded FPS
Too Human. Massively underrated, and was originally going to be a trilogy.
Just a shame that Silicon Knights ended up screwing the whole thing over by stealing source code. I was also intrigued by the idea of more futuristic Norse mythology/technology.
Yeah, was talking to someone about it not too long ago – think it was @negativezero – considering how dorky or lame the hybrid norse/futurific thing could have been, it worked really well. Was a solid as hell co-op game too.
The norse myth angle of it was what kept me going. Found the way they’d interpreted it as a SF setting to be fascinating. The game itself wasn’t as terrible as people made out, but it was certainly not great and did have some big issues. With a more traditional control scheme it might have worked a bit better. A better developer could have made something amazing with those ideas.
Pretty underrated that one… I remember that once I finally ‘clicked’ with the controls, I turned into a badass at that game.
Interrupted flow, lost my place, tried to come back to it but could never grok the controls again. Ever.
Yeah was such an odd duck of a game. So many glaring flaws, but at the same time it worked so well. Think that’s what gave it so much character to me. RE Operation Raccoon City was another similar example – so busted in many ways, but so awesome in others. Co-opped the shit out of that with mates as well, and had a blast, despite it getting panned across the board. *shrug* A beautiful disaster, or something.
Major Stryker.
I was thinking about this the other day, one game that had a few problems but was a genuinely a great game was Too Human. Too bad that will never ever happen.
A new Jade Empire game would be great too
You know what would be the best thing ever? Too Human being continued by Epic.
I’d love a new Jade Empire. Actually I’d really like to see Bioware do something that isn’t Mass Effect or Dragon Age since the last installments of both of those have kind of put me off them.
Jade Empire HD rerelease followed by a sequel.
Commander Keen. 2D Duke Nukem/Nukum.
This is me being ridiculously nostalgic and hopeful but I would really, really enjoy a new Crash Bandicoot. I never quite got into Jak and Daxter or Ratchet and Clank in the same way.
I played all 3 Jak games, it had its moments with the characters but all in all I wasn’t that impressed, and the controls kept getting in my way on the Vita version which made some sections REALLY frustrating.
Sakura Taisen. It’ll be 20 years old next year (original game released on Saturn in September 1996). Remake the first one, give me a sequel, a prequel, I don’t even care. Just fucking let someone localize it this time. 🙁
Playing through Project X Zone makes me realise that I missed all of these cool Capcom/Sega/Namco games in the 90s and 00s that I’ll probably never get around to playing. It’s a massive shame because the Sakura Wars series looks really interesting.
Sakura Wars was fucking awesome. Absolutely massive in Japan at its peak and had a big impact on a lot of things that followed it, both games and anime. The setting’s unique – 1920s Taisho Japan. That was the point that Japan had thoroughly modernized and industrialized and was emerging as a military superpower. Plus steam-powered mechs. Also that melding of steampunk and supernatural fantasy is something I don’t think anything else has done, or at least not as well.
Sakura Shinguji is one of my favourite characters ever as well. And the main theme is still fucking rad.
For better or worse, it shaped the way a lot of modern JRPGs are built. Massively influential on visual novels as well as one of the early titles to legitimize that genre.
The TV anime is a pretty good adaption of the first game if you wanted to examine it deeper. Probably not streaming anywhere (it was an early ADV release and probably lapsed by now) but I don’t think you’d have much trouble finding it if you looked around. The only game localized was Sakura Taisen V on PS2 which is a good game but pales in comparison to 1-3. Better than the trainwreck of Sakura Taisen 4 though. The biggest issue is that by V it had started to get a bit rote and kind of silly (the main heroine’s name is Gemini Sunrise and she’s a Cowgirl… Can’t hold a candle to Sakura or even Erica)
Also give me a modern survival horror / lite RPG remake of Pathways Into Darkness.
Going for the niche corner, I see.
I’ll admit, Oni is the Bungie game I’d most like to see again. Sure, it’s a bit rubbish at times, but it’s probably my favourite Bungie game (though that may be influenced by the fact that I could never actually finish any of their earlier games).
Oni wasn’t a true Bungie game though. It was developed by a different team (Bungie West) and they sold it before it was done, which is why it showed a lot of promise and then turned out to be a disappointing find-the-key-to-open-the-next-warehouse-door sequence. Really wanted to like Oni. It also predates the point where developers basically nailed doing 3rd-person action games. I’d love to see it revisited and done properly.
Funnily enough, you know who owns Oni now? Rockstar. Imagine that game getting a Max Payne 3 style treatment.
Mega Man Legends 3 of course. That said I’m also looking forward to Blast Corps and Jet Force Gemini next week. Hopefully Microsoft will be inspired to get something new out with those IPs sooner or later. I mean the idea that they didn’t launch the XBOX 360/XBOX One with a Blast Corps game tailored to showcasing the power of their new hardware is just bad marketing. Do it right and it’s the sort of game that leaves the competition struggling to respond even when their hardware is undeniably superior.
Isn’t that basically what the Red Ash game on Kickstarter at the moment was intended to be?
Yep. They’ve even got a ‘mock up’ you can download or play in your browser that’s essentially just the first shopping area from MML. Not quite the boss battle demo people wanted, but you can kick cans around. Such a shame that it won’t reach it’s funding goal.
There was a game… I can’t remember the name anymore but there was a game. Where you played as a human in the future and earth gets invaded and either your brother/wife gets taken by the alien menace but you escape with the other and start developing powers eventually overthrowing the alien menace and revealing the human race to be the savior race or something like that. I’d love to see that continued as it was designed as a trilogy originally I think? Anyone remember the name?
Closest I can think would be Steel Harbinger but it doesn’t sound quite right.
I REMEMBERED! It was called advent rising and it was awesome :'(
Edit: And while trying to jog my memory to remember it I came across another game that I’d like remade! Freedom Fighters! That was another awesome 3rd person shooter :O
I still have that on my ‘completionist’ pile of shame. That was a pretty damn great game for its time.
Yeah it was almost 10 years ago… really sucks they couldn’t make a sequel =[
I was thinking about this the other day and realise something I really want.
I had an old sci-fi RPG called Megatraveller and now that I’ve been thinking about it I would love a reboot of that.
Psychonauts 2, BG&E 2 although I guess that isn’t really a franchisee.
Just finished the first coat of the first boot. Took about an hour and a half.
Really wishing I just took the quick-and-nasty route with spraypaint.
When you’re rockin’ ’em like a baws you’ll be happy you did the multi-coats!
Dark Souls III
“Hidetaka Mizayaki, Dark Souls 3 director, said that the game is an absolute adrenaline rush that will follow the success of the past 2 instalments”
Dark Souls III pre-order bonus is a poster of a character known only as The Red Knight
‘Should of’
No. STOP IT.
*dives out nearest window*
Someone probably should of stopped him diving out that window.
Should of is one of my pet peeves. It makes me feel dirty just writing it to say how much I hate it. Should’ve is acceptable, as is should have. I think the reason that should of is used is it does sound a lot like should’ve and people get confused.
Question page 4?
Saw on Reddit and I thought it was pretty good so why not repost here?
What is the worst control scheme you can think of in a game?
Aside from deliberately bad/difficult control schemes (QWOP, Surgeon Simulator etc).
Tank controls. Grim Fandango.
The horror. The horror
This so much. PSone games like Fear Effect 2 were completely unplayable personally.
This may have also included Resident Evil and Tomb Raider, I think?
I don’t remember Tomb Raider having Tank controls. Silent hill did.
I didn’t find them unplayable at the time but now the entire concept is just insane. I think at the time nobody was doing decent 3D controls so pretty much every game had 20 minutes of adapting to janky controls at the beginning.
Dark Souls I or II on KB/M. That crap is nigh unplayable.
Anything that doesn’t let you invert Y.
Capacitive touchscreen controls.
They are discriminatory against those of us with haunted fingers.
Capacitive? That’s only like 99.99% of touchscreens in circulation today. Don’t tell me you prefer resistive touch?
Ok I won’t tell you.
…
Resistive forever! \o/
Ugh. Resistive touch smartphones are the absolute worst.
Can’t say I’ve ever tried one. Nor would I want to. I’d rather go back to having a phone with buttons 😛
Reasoning time: mainly it’s the fingers thing. Mine like to either be ignored by capacitive screens, or detected as touching when they’re still floating above making no contact at all. Then there’s the whole finger thing in the first place, I hate smearing my screens with fingerprints and will generally use a fingernail or stylus instead. Drives me up the wall when people smear their fingers all over my gamepad or DS screens.
Also being able to use any old thing to activate the screen is nice, instead of needing a finger or a specific type of stylus. Accuracy is another thing, fingers are so fat and horrible to use for anything requiring any kind of precision. And I disagree with having the screen be activated by touch alone. When you use buttons, you feel for them with your finger first before you actually press them. You don’t get that with capacitive screens, if you get too close then you get an unwanted misfire. Resistive you can still touch the screen and probe to find where it is without activating it.
…And that’s another Gooky interface rant 😛
I just figured it was patented Gooky hates improved modern versions of things.
I only hate them when they’re “improvements” in name only 😛
Oh, sideways Wii remote. Since the d-pad sucks for use as an actual d-pad (as opposed to being treated like a set of four face buttons). It gets even worse when they make you use the A button too. Then moreso when you have to use the B button. And even worse still when they make you flick it out sideways to use the pointer, like in Metroid Other M or Super Paper Mario. If you wanted to use pointer controls then why not just let us plug in the friggen nunchuk. Ugh.
Gunvalkyrie. Original Xbox.
Kid Icarus 3DS has a fucking awful control scheme too.
DB Xenoverse. You can get used to them but the controls are pretty wonky.
The way TFS do it is just hilarious as it’s the same thing every time.
*punch punch punch punch whack*
*WHOOSH* “DADDY!”
*knocks guy into the air then repeats from the start* 😛
“Mega-Ultra-Super-Hyper-Alpha-Whatever!”
Any game requiring the constant use of the old PSP analogue stick.
MGS Peace Walker PSP. The game allowed for you to select between differing control schemes but my God, none of the options were even slightly comfortable. Very awkward.
There’s a reason I never got real far in the PSP version of that.
Good ol’ PSP claw.
That. Rear. Fracking. Touchpad on the Vita!
The original System Shock. I tried to go back and play it recently and it was terrible. I don’t know how I played it in high school. No mouselook support that I could discern since you have to use the mouse to activate options in the HUD, you have to steer your character with the arrow keys. Strafing makes no sense, you have no situational awareness and to lean around corners you actually use the mouse to click the profile of your character in the HUD to orient their body. There’s a plethora of other issues but it felt more like trying to pilot a spaceship through an asteroid field than walking across a room.
Goddamn. One of the most remarkable games I ever played but I couldn’t possibly go back to it now.
Tilt controls. Anything that uses them. Something has gone fundamentally wrong if you ever even consider putting tilt functionality in your game.
Even Super Monkey Ball?
Better with a stick. By far. Fuck tilt controls sideways.
I can’t even remember if/which SMB used tilt controls, let alone if it was bad or not. Gotta be better than using the balance board 😛
Tilt controls in Splatoon are fantastic though 😛
I remember when I was a wee lad we had a disc full of demos from ’98 or ’99. On the disc was a demo for Tomb Raider II, which I loved.
Except I could never figure out how to shoot my guns.
So I just stood there on a rock with my guns pointed at the wolves, unable to do anything but stare at them.
Looking back I don’t know how I enjoyed that.
What was the secret?
Actually I recall finding a Tomb Raider demo on PC which I tried playing, but also couldn’t figure out the controls. Though for me it was scorpions that I was staring at.
Yay! I just won 2x 3 day passes to PAX!
It was through another gaming website, but yay! One less thing to buy 🙂
Yay! Paxingmama!
Paxing, v: To attend a gathering of nerds in a wholehearted fashion
Look at Cookingmama over there, she’s paxing sweet right now
Sorry boss, I can’t come to the company breakfast event, I’m paxing
Oh wow! Congrats! 😀
You’ve been going to other gaming sites? D=
Seriously though, congratsJust the ones who put their ticket comps on twitter 😉
That’s awesome! One for me, one for you? 😀
Don’t take me seriously, I’m likely not attending this year though I did have the best time at last year’s PAX! It was so awesome.
Wait I thought I was getting the second ticket…. OK! Now we need clarification on this =@
Sorry dudes. @batguy gets first dibs.
Ugh. If you love the guy so much, why don’t you marry him? 😛
It’s ok DC… we’ll always have each other!
Went to see Ant Man last night. I rather enjoyed it.
Also played Life is Strange episode 4. Spoilers for Life is Strange episode 4:
The alternate reality didn’t play out how I thought it would. I expected Max would use her friendship there with Nathan and Victoria to find stuff out, but it was just Chloe stuff.It was cool they let you visit Kate Marsh in hospital. Given that she could be dead, I never expected to hear from her through anything but text messages again.
The episode was longer than I thought it would be. I expected it to finish when you found Rachel’s body, with The Vortex Club party happening next episode. Glad it was included in this episode though.
For the next episode, I’m expecting Max to use the photo Warren took of the two of them at the party to go back in time to that time and save Chloe.
Ooooooh! Of course! I totally forgot about Warren’s photo!Hey best friend @shane, did you ever play The Vanishing of Ethan Carter? Now on PS4!
Nah, but it’s on my list the next time it’s 60% off. I really can’t justify buying more games right now unless they’re mega-discounted.
Yeah, that’s fair. Would be something you’d be interested in I think for sure, but yeah, it ain’t going anywhere! 🙂
Yup, I’ve still got the list of games you recommended when I first considered getting a PS4. Working my way through it slowly. 🙂
Best friend status in tact!
You know what would be really cool? Like a home I.T, A.V consultant whom you engage to give you advice and set up something Technologically related.
I can’t count the amount of times I wish someone could explain to me why my do speed test tells me it’s 15mb/s down but then only downloads at 1.8ms on Steam or how to set up a laptop to work with an extra monitor screen. I would pay people money for this knowledge an expertise.
Like a home entertainment consultant…
Monitor thing is pretty easy! Just plug second monitor into HDMI port, right click on desk top and go to screen resolution. Then just extend to both displays and choose which is screen one and which is screen two! And then dance, friend! DAAAANCE!
Or, on most laptops, Fn + f5 or F6. Whichever laptop button has the pic of two screens
Most speed tests give you your line speed (theoretical maximum basically) not actual download speed.
Try ozbroadband speed test, gives you both.
I think that was what I was looking at though :S Could It be I’m trying to download stuff when everyone else is, or that maybe I’ve gone over my cap limit? (I’m house sitting for someone at the moment so I’m not clear on how to check lol).
‘shrugs’ I’m no professional.
With that specific example, you’re actually looking at two different units of measurement. The speed your connection is synced at is in Megabits per second, whereas Steam measures in Megabytes per second.
There’s 8 bits in a byte, but for a layman’s estimate of download speed, divide your sync speed by a nice simple 10, i.e. on 15mb/s you should be downloading via Steam at around 1.5MB/s
Not sure about Australia, but the service you’re describing sounds kind of like Geek Squad.
Ahhh how stupid I am, thank you!
Not stupid, just unaware. The difference is that asking questions fixes awareness 😛
It’ll be 15Mb/s rather than 15MB/s, sounds like the same thing but the small b means bits rather than bytes so it’s 1/8th the speed seems. There’s also limits on the speed at every link along the route and you’ve probably got at least 3-5 between you & the download server and that’s assuming you’re downloading from a local mirror rather than the main US one.
That makes much more sense now, cheers!!
Hehe so about paying for this knowledge…
Oh, you want to be paid now huh? That sounds like a reasonable thing to expect, you know I really appreciate your hel-
*Jumps through window*
This is why have a kid/grandkid/nephew/niece. Then you get that sort of help for free 😐
I have a 10 year old Cousin who showed me how to play Minecraft with guns two weeks ago lol.
One second coat and one first coat done. Not sure if it is tiring work or it’s just shitty sleep killing me.
Looks like it might need three or possibly even four coats though. Bleh.
That’s always the way. I’ll only need this many layers. And then times it by 3.
Wanna do the next couple for me?
Thanks you’re the best.
If you do my sequins!
Ok deal.
*has no idea what he’s signing up for*
In an effort to wage war with the renovators downstairs I broke out the baking goods and made cookies.
I ate too many cookies. Please bury me at Makeout Creek.
I can bury you at Makeout creek.
I dig that hole area.
*downvote*
Only if I can keep your baking goods
I went to target today to go and get a cover plate. I was after a few different ones and most stores don’t sell them anymore. Target had quite a few and not only that, they had the Alpha Sapphire and Omega Ruby one I wanted.
Anyway, they were locked up, for whatever reason. While I was looking, I could hear a woman getting frustrated and saying “Come on” and tutting. She was pacing the music counter the entire time I was trying to figure out what plates they had (they were locked up so I could only see a few).
The worker returned and explained that she couldn’t find any PS4’s in the 1 TB that she was after. She immediately burst out “This is ridiculous! I TOLD the girl on Monday to HOLD me a PS4!” The worker said that she knew but as she wasn’t working that day, there wasn’t really anything she could do personally. The woman began to say how the girl that served her was a small, skinny Chinese lady but the worker responded that without a name, there wasn’t really anything that could be done.
The woman demanded that she ring every store to check to see if they had them. The worker said that she’d try online, but unfortunately they were sold out everywhere.
The woman asked about the next deal up and the worker replied that they had plenty out the back. To which the woman demanded “I will pay that price there, but I want the 4 games for free!” The worker tried to explain that she was in no position to authorise that and the woman cut her off with the “Well, get the manager then!”
I was waiting for the worker to finish with the angry lady and decided to check out what the games were. God of war, the crew, LBP3 and a $22 quickflix gift card. I couldn’t believe this woman was making such a fuss over games that wouldn’t really be that hard to get. I could understand her frustration, but I couldn’t really understand her taking it out on the worker when it wasn’t her fault.
The woman then told the woman to serve me while she waited for the manager. When the worker came over I was polite, nice and told her that I was sorry that she was being treated as she was. The worker was appreciative and I think relived as the manager came up to deal with the problem.
I said, “I hope the rest of your day is better.” And she seemed pretty glad that I wasn’t going to yell at her too.
I seriously don’t understand the anger. I mean, if she’s that deperate for a ps4, why not see what deals all the shops have got? Why not compromise? I did that when I couldn’t get what I want. Hell I put a game on layby and when I went to pick it up, another worker had sold it. I just got my money back and bought it elsewhere. Sure I was disappointed, but they’re people and people make mistakes why is it so hard for customers to understand?
On a completely different note, I am very happy with my cover plate =D
https://twitter.com/scree06/status/626366300705566720/photo/1
People literally go nutso for bargains.
Entitled humans… next thing we’re going to see are people taking helicopters needlessly and thinking someone else should pay for the expenses instead of them.
Wait…
No no, it’s okay. She said she is sorry so everything is fine now.
http://www.theguardian.com/australia-news/2015/jul/30/bronwyn-bishop-apologises-error-judgment-travel-claims
Would it be racist to boo her anyway?
Werr you saying boo or boo-wyn?
Oh, well that’s ok then. As long as she’s sorry, I’m sure she and all the other expense rorting walking cock sockets that fill parliament house have all learned a very valuable lesson from this.
Oh of course, some say sorry immediately, some say sorry after 3 weeks and only after they got caught by the media…
It seems as long as you’re a liberal-sided individual you’re allowed to get away with what you don’t get caught doing with taxpayers money, so they can quietly get back to saying how they’re trying to stop needless spending
Yeah, they’re trying to stop everyone else’s needless spending. Not their own.
Her next act involves removing every labor mp from the next question time so joe hockey can discuss how amazing at money he is
HHHHNNNGHGGHGGSSPPTERHEEDWDWSYIGVFSDIHO:SNFGV!Q!#$ !#$y*
efuiqefgicbnq:vklhhkvcydgbfhqn(p cb#t&*cnopfihji?lfjwe@p”dfj”jigo:hio:H;HPOJP’Hiho;uihv;dhngohohOHFVAOGHB48JIOPF
*AHEM*
http://battletechgame.com/
O_o
*types in email to subscribe*
Just what I was loading up to post about. RPS has a tiny bit of info: http://www.rockpapershotgun.com/2015/07/29/battletech-returns-shadowrun-studio-preparing-mech-combat-kickstarter/
The best turn-based mech game I’ve played is still Front Mission on the SNES. Keen as hell to finally get another brilliant one.
From Harebrained Scheme of all people too.
I enjoyed Front Mission 3 on the PS1
I don’t always retweet Kickstarter campaigns… but when I do, it’s for a Battletech game with a Mercenaries focus.
Their ideas are intriguing to me and I would like to subscribe to their newsletter.
Man I am on top of my splats game tonight. Sniping like crazy.
Feels good to be back 😛
So, it’s 3am and I can’t sleep. :\
I was up then as well! I woke up eating chocolate lol.
@saturday ‘s chocolate?
The box that was returned to me that I sent to him last month?… Yes. *kicks wrappers under table*
…what were the contents of your first box
They are a little different from the second, there were far more different types of Tim Tams and some of the Cadbury Marvellous Popping Candy chocolates best flavours in there which they have stopped selling recently.
This week on Pow Are Stupid!
Ever since getting my brand spanking new PC last year I’ve been mildly disappointed that it isn’t as spectacularly “wow, master race!” as I was expecting. I figured that maybe my expectations were just too high.
Turns out all along I had my monitor plugged directly into the motherboard and not into the fancy graphics card that actually does all the work.
Now am like wow master race.
Glasses HAVE made you smarter! Just as the prophecies foretold! 😀
All they’ve accomplished is making me dizzy!
That’s what super genius feels like, Pow! *nods* 😛
*Walks in wearing a robe with the Steam icon on the chest*
Oh my dear Powalen, soon you will witness the ancient art of 60 frames per second and the martial arts of keyboard and mouse. Do you require a bath young Powalen? I still see some of the console dirt on your face and hands…
Okay I’ll stop now 😛
When I saw that you were having performance issues in DBXV I was going to start asking questions, but I got distracted and forgot…
Yep, that’ll do it 😛
It all seems so obvious now 😛
See, if you said “It’s all so clear now” I could have made a glasses/crappy graphics joke.
I saw that coming.
EDIT: Well I thought this was funny 😛
Well you do now, you’re using the graphics card!
Make it anyway, of he hasn’t put them on yet he won’t be able to read it to tell what you said.
*facepalm*
Ask @alexpants what he did with his monitor when he got his shiny new PC…
Hey @alexpants what did you do with your monitor when you got your shiny new PC?
I’m stumped.
More like “Pow master race”!
*Points fingers at @powalen *
Guys? Where are you going?
Khrystle.
Just… Why… what is wrong with parents?
Points at Frank Zappa’s choices for names for his childeren
See, say Moon Unit to people and they’ll look at her weird then write it down. This poor girl is going to be sighing and spelling her name out to people for the rest of her life.
If I had to guess, I’d say the Kh was enticing because of the resemblance to Khaleesi.
*shrugs*
And who doesn’t love a good whistle?
There is a decent chance my son will know a girl called Khaleesi when he starts school next year.
There is absolutely nothing wrong with the name Diva Thin Muffin Pigeen Zappa
They need their child to be unique, no matter the cost.
Remember the good ol days when you could just brand your kids?
*picks up phone* mhm mhm; wait those weren’t the good ol days? we don’t do that anymore? They were cows not kids? *hangs up*
Well this is just awkward.
That’s far from the worst I’ve seen. At least it’s just a dyslexic spelling of an actual name.
Airwreka for Erica
That is painful to read
I came to that conclusion recently, I’ve reached the age that I’m employing people from that era. Where their parents needed to give them a unique name.
Current we have an Aimee and a Lyzee
It’s funny hearing them complain about how people pronounce there name, I have to stop myself from yelling at them, they say it like that because that is what you god damn name is.
Lyz != Liz
Aimee is a legit one though, just the French spelling of the name I think. I’ve come across a couple of them recently, not too much younger than I am.
Aimee I don’t mind, at least it has the same spelling as the way it should be pronounced
But I still put that in the “I need to be different” camp
Which I would never be part of *Ignores the potential baby name list *
My recall ends today, so tonight I get over my anxiety and start League of Legends ranked, pray for me 😛
Should we spend the day screaming abuse at you to prepare you?
I can’t mute you though so… no thanks I’ll be fine 😛
You can’t mute us because you’re terrible at that thing that people who play LoL are frequently terrible at.
I question your ability to play as an effective team member!
Get good, relative to the average skill level of the current game in progress.
I am not good at smack talk.
Your mother is a classy lady!
…Wait did I do that right?
Hearty chuckle, you are obviously new at this game as your lack of experience makes you less skilled than I.
YOUR PERFORMANCE IS SUB-PAR BUT I APPRECIATE THE EFFORT.
If you’d just learn to play and stop being such an awful noob then you wouldn’t need to mute anyone.
Theoretically.
Did you get much done?
I’ve done all the cuts and folds, just haven’t started gluing yet, I can spend some time tonight and Friday doing that.
I need to sew up the shoes and the pouches.
Just in time for Int0 😀
By the way did you see that email I sent you last week?
I did. Very cool, I’ve got it flagged for future, makes me feel like I’m a Cylon now xD
Toaster
A toaster with a swordgun and shotgun, thank you! *pouts*
#prayforTK
*salutes*
THURSDAY TAYDRENALIN SHOT
We live in an age of there being an app for that. What are you still surprised there’s not an app for?
Windows phones. =/
/End Thread
*Scree drops mic*
Sorry for breaking your taydrenalin shot.
I’ll come up with another one 🙂
I don’t doubt it, but I still feel bad.
Ooh! I know, if you could cosplay as anything, what would it be?
……Windows Phone?
Left behind?
Are you trying to ride of my coat tails? *hair flick*
God damm that was savage
I own a windows phone, so yeah. >_>
Wow. Streaming Dark Souls II from the XBOX One to Windows 10 actually seems playable. I would have figured any latency from streaming at all would kill it. If only the HDMI in worked this well.
@scree’s replacement THURSDAY TAYDRENALIN SHOT
If time, budget, and biology were no issue, who would you cosplay as?
I actually had to think about this and I came up with Varia suit Samus. Samus is not really something I could do easily because of the need to pee. I would love to do one with all her armour, lights and stuff, but it’s just not possible due to my tiny bladder. =P
That would be pure awesome 😀
This has been a long-standing dream project for me also.
Though I have superior bladder skills so I would be fine 😛
Then what’s stopping you?
Time, effort, motivation, other things. You know, the usual 😛
Oh so you have the ability, just nothing else =P
Like most things in life 😛
War – Darksiders
Raziel – Soul Reaver
Erhm… Chris Hemsworth?
Chris Hemsworth?
If only I could look as good as him! /o\
Not Thor?
That hair, that beard! *swoons*
A timberwolf mech.
http://i.dailymail.co.uk/i/pix/2013/04/17/video-undefined-1958967A000005DC-922_290x163.jpg
A fully motorised Pulsefire Ezreal final level, his backpack would fully open and close, his cannon arm wound be fully animated and his visor fully fitted out. Also speakers to speak out the lines of his suit’s AI, Pearl.
I’m sorry! /o\
You would probably hate me as that one is fully covered in armour, it’d be really hard to get on and off for things like bathroom breaks.
Well, i would have the same issue as Varia suit samus =P
Just put hinges where the important parts are
Commander Shepard. That guy reeks of cool.
Shepard
Wrex.
Shepard.
Only three years late I know, but no spoilers for Mass Effect 3 please! I’m currently trying to finish off the game on my weekends/when I can.
The Reapers were in you all along.
Shepard was dead the whole time.
Snape kills Garrus.
Wrex is Shepard’s dad.
Something something in the middle of some calibrations
What guy? You mean Garrus
* That chick reeks of cool.
Fixed that, for you.
Hello my loyal subjects.
You should do that anyway.
True story, I’ve wanted to do that cosplay ever since I went to my first AVCon.
If you do do it, you should get a little prince figurine that fits in your hand
At the time I first started thinking about it I had a hand-knitted katamari that was palm sized. Lost it somewhere over the years / house moves / etc. Wish I still had it.
Aw, that sucks. It would just be the cherry on top.
Well seeing as time, cost, and skill are significant factors in me ever doing the cosplay in the first place I’m not too cut up about it. 😛
For sewing, this is a great book
http://www.dk.com/uk/9780241197226-my-sewing-machine-book/
Red leggings, a yellow sash, a ruffle and the top. The leggings you can buy, the rest can be made.
The head…Whatever material you’d prefer.
Yeah, but I’d want the head “pillow” to have matching fabric. Authenticity and whatnot.
Also I failed home-ec big time. I just couldn’t get the hang of anything related to a sewing machine. Kitchen I did great. Sewing… not so great. Since I’m still ok in the kitchen I don’t see that my lack of skill with understanding sewing will have changed either.
The headpiece doesn’t appear to be fabric to me. Too shiny. Too solid.
The way I had it in my head was a cylindrical piece of cushioning material or something (I’m not explaining it well) wrapped in a fabric and with a hole cut through for the head to fit through. Mainly because any alternative I could think of would be uncomfortable to wear for a long period of time.
Wait. I’m not going to do this anyway, why am I letting you talk me in to ideas? :O
Nah, I’d say it’s solid as it doesn’t move when he talks. You could use a wide piece of PVC pipe as it’s stiff and lightweight.
I’d thought about PVC actually, just figured it’d be too difficult to work with and would get uncomfortable after a day of having it stuck on top of your shoulders.
PVC pipe is actually quite easy to work with. A simple hacksaw will do it. As for the comfort, you’d want it to be removable, just for things like toilet and eating. Also, you can stuff the inside around where your head would be so it’s not too hard on your head.
http://meowaboutcosplay.com/guides_tutorials/katamari.html =D
That link’s just reinforcing my whole “if time and skill weren’t a factor” thing. 😛
(But I bookmarked it)
Good luck! I hope you can get it done at some point.
Franky from One Piece, but only if I could do the crying right and somehow fit a fridge in my stomach.
Tyranid BioVore
Protoman
Lee Loo from The Fifth Element, or Effie from The Hunger Games. One is super cool, the other has the best costumes.
On the topic of Mass Effect 3:
I’ve only just finished the Priority Tuchanka mission where you must release the genophage cure. Or not. Damn, the choices you must make in these games really play on my mind. I tend to be more of a Paragon than Renegade and so my first first run ended with me revealing to Mordin the sabotage and allowing him to go up and sacrifice himself. I gain war assets in Krogan but not Salarians with this choice.Then I read a bit more about that scenario and discovered that it is possible to persuade Mordin to not go up thus gaining both races as war assets plus Mordin. So I went back an hour via a previous save and tried to adjust the outcome. That time trigger-happy me killed poor Mordin after I revealed the sabotage but couldn’t persuade him. I loved the way Shepard reacts and tosses the weapon afterwards. So dramatic.
Now I have both races as war assets but no Mordin. I’m tempted still to go back and maybe try to delay him (Renegade option) and see if I can yet pull another outcome. But wow, this game. Never before have I gone back and replayed certain levels in other games before – usually I’m chugging to get to the finish line.
Generally considered good form to spoiler tag stuff like this, even for old games.
Noted. Good call, considering I only just asked for no spoilers, myself.
Even for games as old as SW:TOR. =P
Even as old as KOTOR! Eh @rize? @rize @rize eh? @rize
That’s what I was going for. =P
Did you know Mario saves the Princess? Blew my mind.
Wait he does. I thought she was in another castle
On the topic of Mass Effect 3, I miss playing the multiplayer
For all my issues with the games story, they do a great job of making the entire game an ending and getting the decisions to feel important. Galaxy at War is something I’d normally ignore, it’s a number that as long as it’s above a certain point is fine, but the way it’s all structured made me treat it like it mattered. It wasn’t +6 assets vs +12, it was a meaningful resolution vs a practical resolution. It really blurred the line on Paragon/Renegade choices by making you consider good/bad in the big picture sense rather than the personal ‘do I want more blue or more red?’ sense.
See this is where I actually disagree. Boiling it all down to numbers actually took away any feeling that I had a choice. Especially since you need to basically go all the way renegade or paragon to get a full choice of endings. It meant that I couldn’t actually roleplay it and so I haven’t been back to it for a second playthrough after doing a Paragon run. Doing it Renegade would have required screwing over a bunch of characters I liked and generally acting like a massive asshole, which I never felt was the personality my Renegade Shepard had built up in the previous two games. Choosing to actually role-play the choices means being sub-optimal and locking out possibilities, and that sucks.
It’s why I say that companies like CD Projekt and Obsidian are vastly better RPG writers than Bioware. They encourage shades of grey, rather than the min/max black & white approach of Bioware’s stuff.
I agree with a lot of that in theory, but there was something in the execution that made me look past any faults. The mechanical side was sort of obscured. It was totally in character whenever it came up so I never focused on the number itself. I think a big part of it was that they threw an overwhelming amount of factors at us. You have the choice between the right thing, the practical thing, the long term consequences, the short term benefits, Shep’s interests, the Alliance’s interests, the galaxy’s interests. Galaxy at War was simple but combined with everything else going on and the significance of knowing the end of the trilogy meant it was the deadline for everything I think it really worked.
That complexity is annoying when you’re trying to min-max, but I think it’s really good for making the player tell their own story and make their own decisions. I normally go Paragon for my main runs but in Mass Effect 3 I felt like it finally pushed me out of that. It wasn’t just about hitting all the blue prompts it was about making decisions.
From a roleplaying perspective I figured it would help add depth. I mean you’re trying to save the galaxy and the asset stat, while simple, gives you a good way of tracking one of your characters primary motivations. It provides your character a reason to actually consider choosing an asset over a friend. It makes it more serious when you throw away a chance at a good asset in order to do what your character thinks is right.
In the previous games I felt too much freedom to do what I want without consequence. Paragon every time. The worst it cost me is some reward I didn’t really need anyway. In ME3 I felt like it was saying ‘you can do what you want, but it might cost you some assets, and if you don’t get enough assets that may cost you the ending you want’. Of course on my second playthrough it was much clearer that I could just get my Galactic Readiness up to 100%, do the DLC, and get the best asset rating without even trying.
There is literally no work for me to do today! I’ve emptied the ticket queue, waiting on other departments for my projects and everything works… Time for some job hunting on company time! \o/
I’m seriously bored out of my skull… Why am I here?
Should I make my 3rd coffee within this hour? Seems like the advisable thing to do
And thus begun the Pixel Ferrett’s spiral downwards to madness, watch closely as he posts more inane ramblings.
Nooooo i would never do that, I couldn’t hold a candle to Blaghspam!
I’m just so boooooooored though
Hey Pixel, that coffee was a great idea! Why am I vibrating?
I can see noises!
The come down from this is going to be a glorious train wreck
It’s one of life’s great mysteries, isn’t it. Why are we here? I mean, are we the product of… some cosmic coincidence or, is there really a God… watching everything? You know, with a plan for us and stuff. I don’t know man, but it keeps me up at night.
No dude, I mean, why are we here? In this canyon?
nice RvB reference if it was meant to be that! 😛Totally 😛
I just went from that to “We need someone who is at minimum better than ‘totally incompetent’ to help catch level 1 up. Can you pitch in?” so now I have literally over 500 calls to sift through and resolve or delegate. Wanna help?
Sure? I’ll jump on my tricycle and be there shortly!
How to help level 1:
Step 1: Escalate to level 2
*looks at level 2 queue*
WHO DUMPED ALL THIS SHIT IN HERE?
*escalates to level 3*
And then the line continues…
*Level 3 looks at queue*
“Who dumped all this shit in here!?”
*Escalates to dev*
*Looks at Dev queue….ignores*
6 months later…
“Will not fix”
EDIT: This shit got way to real quickly…
You need puppy pics.
Also, we have a few new dogs at the dog park. Cassie, Titan, harvey and Blue. Harvey is like a Scottish terrier cross everything. So weird.
Blue is a long haired border collie that will only play with the knobbly ball.
Cassie is lovely, but she will kiss you any chance she gets.
Titan constantly has the ball in his gob and makes the most hilarious noises.
I do like puppies! So about that dog meat! 😀
Yeah, I need to tag victorian taybies and stuff…
Hey who wants to break open my skull with a sledge hammer? It would be a hell of a lot less painful than the migraine I am dealing with currently
Are you saying it’s time for us to crack each others’ heads open and…feast on the goo inside?
Yes I [am], Rize.
Ooh, The Order 1886 finally dropped to a price I was willing to pay ($36) so decided to grab it.
Also picked up FF Type 0 for $40 while I was at it. Still comes with the XV demo too. Preorder only my ass.
I don’t think it was ever pre-order exlusive. It’s printed right on the game’s cover that it includes the demo, which is why I was able to get my refund when the code didn’t work.
http://www.digitaltrends.com/gaming/final-fantasy-xv-demo-will-exclusive-final-fantasy-type-0-hd-day-one/
‘Day 1’ i.e. first production run editions have it. Digital copies had to be preordered or bought within the first month to get it.
I guess that means there’s still a whole bunch of first editions here.
Where did you get The Order at that price?
EB.
My local 2nd hand has it for $29.95, I think. And FF Type 0 for $35.
@freezespreston: curious as well, though I think my personal limit is more like $25 and I have a ton of stuff on my list to play already.
I have the Order sitting on top of my PS4 still untouched (got it with the console).
Perhaps we should finally institute the TAY games club.
This morning I was sitting in my favourite chair in the corner of the loungeroom, leisurely finishing off my breakfast and watching Masterchef (I’m three weeks behind, if somebody mentions who won they’ll find out why I’m secreting away knives in Pants’ TAY soap opera!) when my chair started vibrating. Couldn’t figure out was going on and decided that my crazy old lady brain must have imagined it.
A few minutes ago, one of my Instagram friends asked if I was okay after the Brisbane earthquake.
Yay, I’m not completely senile yet! 😛
Just how old are you exactly? 😛
I’ve forgotten.
Where are you up to?
Mrs Tigs is behind as well, but she can’t watch it unless I’m home so that I can queue it up for her so she doesn’t get spoilers from the other episode pictures.
We have about a week left to watch
I just watched the Darren Purchese pretty flowers episode
(the one where Ashleigh went home. I’m glad she went home, because she irked me by styling herself as a dessert queen, while having such a huge lack of knowledge of the basic elements of things. It’s good she got a job after the show was done, because now she can fill in her knowledge gaps and live up to her potential.I have the Tenplay site open in a tab, with the page scrolled down to where I’m up to, so the preview pics don’t spoil me.
I didn’t think she was too much thinking she was a dessert queen. Certainly thought she was stronger on dessert. In a way it was probably good for her to go home, I think she would have imploded horribly as the pressure ramped up down the track.Ordered a new laptop to replace my broken ass old Macbook Pro. MSI GS60 Ghost. I was originally going to wait and buy in the US, but I did the sums and the equivalent in the US was going to end up being within about $350 AUD of the local AU price, and factoring out GST (which I will be able to claim back as I will be leaving the country within 60 days) it’s more like about $150 difference which isn’t worth waiting for.
Excited to finally have a laptop that won’t switch off and hard reboot the instant I bump the power cord. Also one that I can actually do things with. Probably will be my primary gaming system for a few months when I move.
How much was it putright? Im looking at getting a new laptop or PC
$2599 AUD.
I would recommend holding off installing Win10 on it for a week or two though. Complete shitshow. No drivers on their site for half the stuff.
Also amusingly, it comes with a drivers disc. And no optical drive.
Someone in my office has the Legend of Zelda Windmill Song as their ring tone, I need to find this person immediately and become best friends with them.
I once worked with someone that used the fanfare that plays when you get an item from a chest as their message notification. It was pretty cool.
However another unrelated person I briefly worked with had the fucking navi ‘Hey’ sound and got texts all the fucking time, like 1-2 a minute. That guy sucked.
I had that as my Twitter notification for a while…but when you say something and get 8 replies and 10 favourites in 10 minutes it’s hard to decide if it’s still funny 😛
Necessary to point out that my phone is on silent at work. Regardless of alerts/ringtones, if you’re in a quiet(ish) office, it’s the polite thing to do.
Yeah, on that, I don’t think I’ve actually sent a ringtone or message tone for several years now since the phone’s always on silent anyway.
Yeah, Navi would be annoying for that!
… Now Trunks from DB Xenoverse, HEY! would be 10 times better right? RIGHT?
I swear to god someone in my office had the Mario coin as one of their notification sounds.
I asked the guy who was the most likely candidate and although he claimed it wasn’t him, I could see the fear in his eyes as if I had found out his dastardly secret.
He quit soon after.
Coincidence, I’m sure.
I used the Song of Storms as a text notification for ages. While it’s an awesome song, having an alert that goes for like 6 seconds is really annoying.
Especially when you’re in a meeting! XD
I’ve had the Metal Gear codec noise as my message tone for years
I had the MGS “!” noise as my message tone for ages, but keep forgetting to put it on my new phone.
I’ve got the Battletoads opening theme for my ringtone, and the end-of-level jingle as my message tone.
For some reason people seem to find my message tone annoying. I kinda do too (in a “who is messaging me? And why? Stop making noises happen” sense), so my phone usually gets silenced.
Oh and before I’d gotten around to recording those, I didn’t really like any of the default ones so just made an obnoxious set from what I had on hand – ringtone was Ram It Down, and message tone was the intro to The Ripper.
Kinda miss having those 😛
I once had a co-worker who used the Spice Girls ‘Wannabe’ as his ringtone.
In 2009.
At full volume.
He took multiple calls every day, too.
Did he ever tell you what he wants?
Better taste in music, apparently.
I had the Gold Saucer theme for ages because it was loud and obnoxious and I could hear it.
Currently have Waltz for the Moon.
That used to be my ringtone and the “dah dah dah dah!” used to be my message tone.
Now I have the “Dah, dah dah dah dah!” as my message tone, Ocean from windwaker as my ringtone and morning as my alarm tone.
I have the “BOOSTO” sound from High School DxD as my phone notification.
My notification tone is heyo from BL2 and the message tone is the old spice whistle..im cool
Sweet! just got confirmation that I got a job I applied for where I am already currently working (although I wasn’t permanent). Literally changes nothing in my day to day work except I actually get sick leave & annual leave.
Benefits!
Yay for work rights! (We still have those right?)
Huh?
Just my obscure commentary on how jobs with full time responsibilities don’t come with full-time benefits. Surprisingly more and more of those jobs these days.
It was a joke. I was saying “huh?” as in the words “work rights” was a completely foreign concept. =P
*head desk*
I brought my very first mobile phone in to work today to show everyone, a Nokia 8310, and surprisingly the thing still powers on and holds a charge. Hmm, maybe it was my second..
Booting up Snake II for the first time in a long time, I’ve only just now discovered that I can play with one button – the down button – and the snake’s directions change in a clockwise pattern. :O
Mind blown. Had I known this back then, it’s possible I could have played way more Snake.
Snake > Snake II 😛
Also never knew there was an 8310. My first was an 8210, then upgraded to 8250 we had lying around, for the ringtone composer. You could play Snake with two buttons, each of the corner buttons (1, 3, 7, 9) made the snake turn towards that direction (eg if he’s going up or down then 1 would make him turn left, if he’s going left or right then it would make him go up) so if you picked two diagonally opposite buttons to keep your thumbs on then you were set. Way better than using fixed directions on 2,4,6 and 8.
How do you find navigating the menus, and punching out a message? Doing that when I last fired up mine made me miss the buttons so bad 😛 And the responsiveness! You click something and it happens instantly! None of this swipey wait-for-the-animations-to-finish bullshit. So good.
I had less typos when using phones with physical buttons, that’s for sure. 😛 The 8310 is like the fat cousin of the models that you had – I remember yours. I also remember paying a fellow student $300 for the phone outright, it was a fair chunk of cash, but sharing items among fellow peers was sometimes the easiest way to obtain things. Way easier than trying to get a phone on a contract when you’re 16.
Was the 8310 the one where you could play 2-player snake via the IR ports?
I have no idea! It does have an IR port though.
Aha! I was right! had a few friends doing this… Pain in the neck was you HAD to keep the phones that close to ensure they didn’t lose connection 😛
I think you could do that on the 8200 phones too, pretty sure it had a two-player option in there. Don’t think I ever tried it though.
The 3310/3315 were all the rage when I was in high school, but I ended up with some shitty Kyocera thing. I WAS SUCH AN OUTCAST.
I think the 3315 may have been my first phone, I’ll have to compare the release dates.
I was totes cool with a 3510i… Mother fracker had a 96 x 65 COLOUR DISPLAY! AND POLYPHONIC RINGTONES! ooohhh yeeeeaaah! 😛
My first phone was the Nokia 6150
That thing was the sheez! Could even act as a bottle opener in a pinch… veeeery important for students!
Haha, similar to the 5110, I see.
Coding people (@fled, @negativezero, @batguy just from the top of my head)
I’ll just leave this here.
http://lhartikk.github.io/ArnoldC/
Eubonicode (https://web.archive.org/web/20050331030808/http://www.public.iastate.edu/~crb002/prog.html) was always funnier. Syntax works better.
So I was thinking about the types of games I like vs the types of game that are available.
Had this idea for a competitive, tactical, squad-based, turn-based game.
You’d start by making your squad of 6 characters.
Each character comes with an initial allowance of currency.
Each has various stats like health, accuracy, speed & strength.
You’d start in the “friendly” zone. (No permadeath).
You’d be given a list of opponents to choose from in the lobby.
You can check out the last three load-outs used by your opponent.
You’d outfit your guys with gear & supplies bought with your initial allowance.
You & the opponent put down a wager.
combat would be pretty much identical to XCOM : Enemy Unknown.
winner takes the kitty & a few random bits of gear that they can use or sell.
loser gets a few bits of lower quality gear / salvage.
gain XP for winning. loser doesn’t get XP.
once your team levels up, you get attribute points to increase individual characters stats.
rinse & repeat up to level 20.
once your team hits level 20, you can enter the hardcore league.
same as above, but permadeath. also, the prizes are much better.
if a character is killed, there’s a 20% chance the opponent salvages their gear, 50% it’s destroyed, or 30% it’s recovered & re-useable.
I’d also have a level editor so each player can create their own ‘home ground’
home player has to put down 150% of the challenger’s wager. so it’d be harder, but the rewards would be higher.
Ever have those days where it feels like your head’s underwater? Man I’m just completely out of it today, don’t even know where the day’s gone. *plops head onto desk*
More coffee.
I’m trying to find a day where it doesn’t feel like that.
How does a man make tea in Israel?
Hebrews it. #dadjokepagesix #hi@strangeMan, I almost went and made a contextless post about how much all this kneeling is killing me.
That was a close one 😛
My friend is moving to Seoul. He thought it would be a good Korea move.
DC’s account has been hijacked, guys. 😀
Dead 2 me.
A new game by Turtle Rock Studios! Choose from over 8 different editions!
What’s round and bites?
A vicious circle.My wife called me while I was at work.
“Honey, I’m getting contractions,” she grunted. “I need you to drive to the hospital.”
When I got there I called her back and said, “What do you want me to do now?”
This is something I would probably actually do.
I visited a Mandarin Library yesterday, it was full of Chinese whispers.
I’m going to try some dangerous coffee. Safe tea first, though.
A Sparky (an Electrician – claimed to be the ‘Royalty’ of all trades) dies in a car accident on his 40th birthday and finds himself at the Pearly Gates. A brass band is playing, the angels are singing a beautiful hymn, there is a huge crowd cheering and shouting his name and absolutely everybody wants to shake his hand.
Just when he thinks things can’t get any better, Saint Peter himself runs over, apologises for not greeting him personally at the Pearly Gates, shakes his hand and says “Congratulations son, we’ve been waiting for you for a long time.”
Totally confused and a little embarrassed, the Sparky sheepishly looks at Saint Peter and says “Saint Peter, I tried to lead a God-fearing life, I loved my family, I tried to obey the Ten Commandments, but congratulations for what? I honestly don’t remember doing anything really special when I was alive. Is it because I’m a Sparky, the ‘Royalty’ of all trades?”
“Congratulations for what?” says Saint Peter, totally amazed at the man’s modesty. “We’re celebrating the fact that you lived to be 160 years old! God himself wants to see you.”
The Sparky is awestruck and can only look at Saint Peter with his mouth wide open. When he regains his power of speech he looks up at Saint Peter and says “Saint Peter, I lived my life in the eternal hope that when I died I would be judged by God and found to be worthy. But I only lived to be forty.”
“That’s simply impossible son,” says Saint Peter, “we’ve added up your time sheets.”
I love this one.
For more info on how to become less gullible click here.
Links broken FYI : /
“How fast do you think you were going?” asked the policeman
“60kph?”
“Try 130!”
“Okay”… and I sped off.
Take a bow after that one. ( ̄ー ̄)
A drunk was in front of a judge. The judge says, “You’ve been brought here for drinking.
The drunk says, “Okay, let’s get started.”
My wife walked in on me making love with the neighbour in front of our bedroom mirror.
I said “I know what this must look like”.
“Goodnight honey” I said as I got up and went to go to bed. I’m trying to make the Vegemite jealous.
Men apparently think of sex every seven seconds. Lucky I wrote this in sex.
The other day I got a torrent of abuse. Which was really bad because it’s not what I expected to download.
Last week I received an email from a user which said, ‘My email is not working. Help.’
True story.
.────────────────────▄▄▄▄
────────────────▄▄█▀▀──▀▀█▄
─────────────▄█▀▀─────────▀▀█▄
────────────▄█▀──▄▄▄▄▄▄──────▀█
────────────█───█▌────▀▀█▄─────█
────────────█──▄█────────▀▀▀█──█
────────────█──█──▀▀▀──▀▀▀▄─▐──█
────────────█──▌────────────▐──█
────────────█──▌─▄▀▀▄───────▐──█
───────────█▀▌█──▄▄▄───▄▀▀▄─▐──█
───────────▌─▀───█▄█▌─▄▄▄────█─█
───────────▌──────▀▀──█▄█▌────█
───────────█───────────▀▀─────▐
────────────█──────▌──────────█
────────────██────█──────────█
─────────────█──▄──█▄█─▄────█
─────────────█──▌─▄▄▄▄▄─█──█
─────────────█─────▄▄──▄▀─█
─────────────█▄──────────█
─────────────█▀█▄▄──▄▄▄▄▄█▄▄▄▄▄
───────────▄██▄──▀▀▀█─────────█
──────────██▄─█▄────█─────────█
───▄▄▄▄███──█▄─█▄───█─────────██▄▄▄
▄█▀▀────█────█──█▄──█▓▓▓▓▓▓▓▓▓█───▀▀▄
█──────█─────█───████▓▓▓▓▓▓▓▓▓█────▀█
█──────█─────█───█████▓▓▓▓▓▓▓█──────█
█─────█──────█───███▀▀▀▀█▓▓▓█───────█
█────█───────█───█───▄▄▄▄████───────█
█────█───────█──▄▀───────────█──▄───█
█────█───────█─▄▀─────█████▀▀▀─▄█───█
█────█───────█▄▀────────█─█────█────█
█────█───────█▀───────███─█────█────█
█─────█────▄█▀──────────█─█────█────█
█─────█──▄██▀────────▄▀██─█▄───█────█
█────▄███▀─█───────▄█─▄█───█▄──█────█
█─▄██▀──█──█─────▄███─█─────█──█────█
██▀────▄█───█▄▄▄█████─▀▀▀▀█▀▀──█────█
█──────█────▄▀──█████─────█────▀█───█
───────█──▄█▀───█████─────█─────█───█
──────▄███▀─────▀███▀─────█─────█───█
─────────────────────────────────────
▀█▀─█▀▄─█─█─█▀────▄▀▀─▀█▀─▄▀▄─█▀▄─█─█
─█──█▄▀─█─█─█▀────▀▀█──█──█─█─█▄▀─█▄█
─▀──▀─▀─▀▀▀─▀▀────▀▀───▀───▀──▀─▀─▄▄█
─────────────────────────────────────
Damn straight.
I think I’ve cultivated enough Milk jokes in recent times, I have to say I’m almost udderly out of all of these cheesey jokes trying to make you cream yourselves laughing.
Gloria the blonde once heard that milk baths would make you beautiful. She left a note for her milkman Alan to leave 15 gallons of milk.
When Alan read the note, he felt there must be a mistake. He thought she probably meant 1.5 gallons, so he knocked on the door to clarify the order.
Gloria came to the door, and Alan said, “I found your note to leave 15 gallons of milk. Did you mean 15 gallons or 1.5 gallons?”
Gloria said, “I want 15 gallons. I’m going to fill my bathtub up with milk and take a milk bath.”
Alan asked, “Oh, alright, would you like it pasteurized?”
Gloria replied, “No, just up to my waist.”Alright, time for my favourite part of the week, Fun Fact Page 6, that I’m considering renaming to “etymology lesson page six” because that’s all I seem to do.
Speaking of etymology, we all know the phrase “let’s get down to brass tacks” which means to get into the nitty gritty of it all, but did you know that -relatively speaking- it’s a fairly young phrase (for an old in-grained phrase, that is)? The fossil record shows it first appearing in an 1863 Newspaper (The Tri-Weekly Telegraph) in Houston, Texas, attached to “if we may use the phrase” indicating that it was a relatively new turn of phrase at the time, and of questionable use in the “proper” language that newspapers of the time tended to use.
All this said, the most interesting part of the phrase is that nobody’s quite sure of what it originally referred to. Theories range from it simply being rhyming slang (facts / brass tacks), to a method used to measure cloth (measuring tacks were placed so they could accurately cut a yard, rather than guessing it), or that it refers to upholstery, and the tacks that were used so heavily there.
Fun fact page six!
After apologising with a staggering amount of insincerity today it’s been revealed tonight that Browyn Bishop had taken a further 15 trips as a chair of a commission when there was no commission business to be undertaken.
http://www.theguardian.com/australia-news/2015/jul/30/bronwyn-bishop-expenses-row-historic-claims-reveal-another-15-trips
FUN! (@beeawwb)
Yes I understand that she’s likely just one of many pushing the boundaries of their entitlements and benefits however all this media coverage is really getting under my skin and I wish the old hag would hurry up and die already so that the rest of us taxpayers don’t have to keep funding her chopper rides and cab charges to weddings and fancy social outings outside of working hours. And that’s all want to say on the matter, perhaps even a little too much.
Personally I’m not a fan of the use of the word *edited out* here. But, uh, I don’t like confrontation, so…
*flees*
…
*flees some more*
…
*And then some more*
No problem. I really should be curbing my use of curse words being a dad and all anyway. 😛
I think it’s a motivation thing? I mean, how am I supposed to stay motivated about my work and just above minimum wage when I’m reading/hearing about stories like this? Pollies can have their benefits and entitlements, I just don’t want to know about it – it’s degrading.
Ugh, I loathe politics. In happier news, today I purchased Snow White and the Seven Dwarfs on DVD from Big W! The catalogue has it listed at $19 but for some reason the checkout scanned it at $15, so, bargain! Unless you’re one to download the film of course.
Also from Big W, I picked up a DBZ Super Saiyan 9 movie collection for $34 – which is pretty awesome – I haven’t seen this collection anywhere else before. The next closest item is the complete 15 film set from Madman for $119.
Hey, do you know about the high level public servant pension scheme? The one where they get payed half their last wage, for the rest of their life, then when they die, their spouse gets that till they die? All on taxpayer money?
Yeah. They are phasing it out cause, yiu know, it was gonna bankrupt the country.
But yeah. Our tax money has always been used to line pockets.
I don’t want to know!
…
Got anything else? 😛
Nothing significant and reliable.
I’ve given up caring much. What’s the point?
Yeah it’s called a defined benefit superannuation scheme; it used to be in the private sector as well but got phased out. I believe they’re slowly phasing it out of government but it’s basically considered a golden ticket in the financial industry cos it’s a secured income stream no matter what happens.
While corporations phased it out quite quickly (I think Qantas still have some but are restructuring to pull it out completely) I believe our government still uses it at certain levels/departments.
Interesting to see you have such a strong reaction. Usually you don’t comment much on political discussions. My wife usually doesn’t care or rolls her eyes and walks out whenever politics gets discussed but even she got loudly angry about this issue.
This seems to be the issue that will sink the LNP above all others weirdly, yet they don’t all set to realise.
You are correct, I avoid political discussions when necessary. Which is always.
I’d be interested to know why exactly your wife feels the way she does about the issue, if it’s not me being too intrusive.
She said she doesn’t mind the government taking as much tax as they do for this g’s like infrastructure, health and education but when we (very) occasionally struggle to find enough money to eat or find enough money for fuel to get to work because of the loss of that money so some woman making 200k+ a year to take a helicopter 80km she gets really upset.
Cheers. That response is much more mature than all mine – I’ll use that one. 😀
These guys are overpaid to begin with, then there’s all the shit they get for free or as extra entitlements that the rest of us slobs have to pay for. Meanwhile they don’t really seem to be doing anything in the interests of the public.
If this were a different time in history, someone would be driving a cart full of TNT under parliament house, and we’d be making movies about them.
I don’t actually care about ‘entitlements’. It’s obviously dodgy, but it’s small potatoes. A few hundred here, a few thousand there. Whatever. It’s a bucket of urine in the ocean.
What really, really gets me mad about politicians is when they dramatically restructure the machinery of government, shifting around units in departments, rebranding department and unit names.
It’s grossly unnecessary, but it happens every single time there’s someone new sitting in the top dog seat. They feel the need to mark their political territory like a dog pissing on a tree.
They CLAIM and hell maybe even THINK that it’s about new strategic directions for their departments and that it will provide some kind of operational improvement, but it’s horse shit because it happens EVERY TIME. Every god fucking damn time – if it were about optimal efficiency then there would be one solution and it would have been found by now and at the very least reverted back to.
And there’s no need for it. There’s NEVER any actual improvement.
IT COSTS LITERALLY MILLIONS OF TAXPAYER DOLLARS AND YEARS OF MAN-HOURS. FOR WHAT IS ALWAYS NOTHING MORE THAN A VANITY PROJECT.
But nooo, journalists can only get us all pissed off about some dinners or wine or car/helicopter travel or a book shelf… It’s fucked. It’s completely fucked. And it makes me so god damn angry every time.
So I probably shouldn’t mention the Browyn has claimed $933,000 of entitlements in the past few years then….
*spasms and thrashes*
http://www.smh.com.au/federal-politics/political-news/bronwyn-bishop-spending-more-on-overseas-travel-than-former-speakers-20150715-gid424.html
Hahaha she spent tax payer’s money to travel overseas for job interviews!
They dug that grave when they targeted Peter Slipper. His $900 of misused entitlements has paled in comparison to Bronnie’s. Glass houses, etc.
Unfortunately the opposition is probably not in much of a position to complain TOO loudly.
Hence Clive Palmer & Co. Andrew Wilikie taking up the fight it would seem, I don’t agree with the sentiment that ‘She’s old and she should let someone else do it’ but in light of the further reports of misappropriation of entitlements I think she has to go.
When both parties have their hand in the cookie jar who exactly is holding them accountable? Public service is now defined as how the public can service you. Anyways as with the Colliseums in Rome nothing will really change; they’ll make a grand show of Bronwyn and distract us with a new fiasco a few months from now and we can all move on thinking the issues have solved.
My wife was home this morning and had Today on as I was leaving for work. They were running a story that Daily Telegrapgh had dug up about an ALP MP who had claimed $4000 on a holiday to Uluru and took his family… Except he was using an allowance that allows them to take family on holiday to assist with work/life balance.
I know the allowance scheme is a hot mess and the MPs know they can abuse the loopholes.
I laughed at 6:45am because it felt like such a desperate ploy by the Murdoch press to find an ALP scapegoat.
I agree the LNP are blind that this could be their undoing. Also believe that which ever journalist pumped out that article has done so at someone else’s directive. The story completely misses what is causing the general upswell of discontent. Bronny has splashed my 2013/2014 taxes on a 100km helicopter ride… to a party… to raise money… for the LNP… and a ducked off for of her mates weddings on chartered planes.
I want to send a 2 word letter to her: GET FUCKED!
I’ll take my tax back thanks and do something useful with it… buy a car… or do some renovations… take a holiday to Perth and drink some nice wine and beer… something that actually helps the economy and puts the money back into everyone’s pockets and keeps them employed.
/end rant
I’m a bit pissed about it… she’s so damn blasé about what she’s done it’s sickening.
/actual end of rant
Reading that back this morning… There are more than a few unfinished ideas floating around that post.
Guess it upsets me more than I thought…
Here’s a way to make politicians have the best interest of the country at heart; tie their wages to the lowest hourly rate earned in Australia.
What’s interesting about the LNP is Abbott’s had like 6 different political implosions since taking office and his polls always recover; something tells me this will blow over long before the next election.
I decided to finally play Dragon Age. I should have expected to be frozen at the character creator not knowing what to do, but here we are. I haven’t even got to the actual character creation yet, I can’t even choose a race or class.
I heard that the city elves have the better story, but I can’t play as a mage city elf. I don’t want to play the mage storyline, but actually playing as a mage seems like the most fun thing. I also really want to play a silly-looking dwarf woman for the comedic value, but I don’t want to miss out on the city elf storyline or the ability to play as a mage.
At this rate, I’m going to spend even longer thinking of character names and choosing how they look.
Okay, gave up and chose a female city elf. Now to spend 3 hours in character customisation, and 2 hours in picking a name.
Oh craaap. I had finished my character and just needed to name her. So I alt+tabbed and loaded up behindthename.com for ideas. When I had decided upon a name, I brought Dragon Age Origins up again, it crashed. My character I spent an hour and a half working on is gone!
Yeah Origins really hates alt tabbing. You can make the game run in a window though, that’s what I did and it did the trick for me
Shift+F1 will also give an overlay with the browser. It’s not as functional as the Steam one, but it is more convenient than dealing with alt+tab instability.
Play a Rogue.
ROOOOOOOOOOOOOOGUES
Rogues
City elves unfortunately can’t be mages. I think you can only be a mage elf which is a different origin story.
Also the female origins are actually really good except for Dwarf Noble which is probably slightly better as a dude.
PS: don’t leave Lothering (maybe 8 hours in?) until you’re sure you’ve been everywhere and talked to everyone there.
Your “PS” is important. I played Dragon Age through to the end twice and both times missed
Leliana. I had no idea she even existed until years later. 😛I didn’t even realise you could miss her 😐I didn’t realise you could go inside the Inn….
I thought she would harrass you on your way out of Lothering if you missed her? Or maybe that’s if you meet her but turn her down. I meant Sten but I do have a vague recollection of one of my other friends missing Leliana so maybe you’re right!
<\s>
Definitely no harrassment. Or maybe too many people were missing her so they added that in as an update later? I know I was far from the only one to completely miss her.There’s heaps of stuff you can miss in DA:O; for example the statue side quest in the mage tower; there was also a hidden ritual in the forest zone that summons a pretty powerful revenant enemy.
My first playthrough I ended up killing a party member… Wynne, didn’t even know she could join up until years later!
Edit: Urgh reminiscing about DA:O and thinking about DA:I just makes me want to punch EA/BioWare.
I played as the male noble with a white beard & hair & wrinkly skin.
My far younger dad kept calling g me “Pup” :-/
Yeeeah. I have spent more time in character creation screens than actually playing the game sometimes.
Dalish elf rogue is the way to go!
Yeah, city elf is the best story & mage the best gameplay
Best to do multiple playthroughs 😉
Don’t let the others fool you with their absurd Dragon Age fanfic.
The Hero of Ferelden is a human noble who ran away to live happily ever after with the mother of his child.
The true hero of Ferelden is an Elf of the Circle that fucked up every bad guy’s shit with lightning and fire but always did it logically and… adequately safely and saved everyone he could. He lived happily ever after travelling with a lovely woman and exploring the world with his knowledge of the Circle backing him up.
A knife-ears being anyone of note? Mind your tongue, heretic!
Ah humans, always so blind and naive. Always being the bully trying to feel superior when really you know we’re better than you.
Oooh, that’s racial
TheOffice.jpg
Just hit two million squidbucks. Exactly 😎
May have thrown that last game to do so 😛 Was a close one though, looking at the map I thought we’d gone and won.
What does one spend ‘Squidbucks’ on?
New gear and weapons. I’ve almost got every piece of gear in the game (minus the stuff you unlock via amiibo) except for ONE FRIGGEN SHIRT THAT WON’T SHOW UP. The shops seem to randomly change their gear each day and I keep checking but they come up with nothing.
Been checking the randoms roaming the streets for the shirt?
Nah, too much effort. And money. Gotta be stingy now I’m rich 😛
Fun Fact Page Six!
I want to punch my homophobic dad in his fucking throat! 😀
That’s not fun. That’s more “fucking awful”
What about his regular throat?
#regularprogramming
That sucks. It can be difficult to deal with prejudices. There’s no way I could deal with that. The fact that you’ve come out to him though is a sign that you are stronger that most people, and are probably stronger than him. Your father’s just going to have to deal with it.
Whatever he says, don’t listen to him. Everyone else likes you as you are.
I’m sorry to hear this friend. You’re a good person Stu and at the end of the day that’s all that matters, even though sometimes we all can forget that.
Here’s thinking of you and hoping that your Dad & you can work through this so that you’re both happy.
*hugasaurus*
🙁
Fucking throat..because his regular throat just can’t keep up with the pounding
Use the spine of a bible instead of your fist! Education with irony!
Should I get that second of 3 piercings I wanted in my ear. Or am I being silly.
I didn’t even know you had a first piercing!
Troo story: my mum let me pierce my ear when I was seven, then when I was 9 i got a second piercing that just wouldn’t take.
It ended up getting infected even though I cleaned it every day & didn’t heal up until I removed it.
I ended up removing the first piercing in high school because kids kept calling me gay.
I never got the link between “I got stabbed in the head with some metal and left it there” and “Actually, men are pretty great in the pantsal regions”.
Kids are idiots. We used to make fun of a friend for drinking tea and now basically all my friends drink tea. Stupid kids.
I still don’t understand tea-drinking. 😛
Me either, but we’re the weird outsiders now. 😛
I think it’s kid logic of: girls traditionally wear earrings & girls like men, therefore you are gay.
As in, no logic.
My favourite one was where the boys who hung around with the girls in the playground were labelled as gay.
I’m sure it made sense at the time.
Haha, though truthfully a lot of them might have been gay, more comfortable with girls than boys, etc. XD Although yeah, hanging out with girls doesn’t make you gay as a rule and it’s just a stupid assumption to make. Just a lot of gay guys did is all. 😛
It’s more a culture thing. Ideally boys and girls should have been able to hang out fine, but that’s not what people did in the school yard and if you did something different to everyone else you were weeeeeird. 😀
Just remembered, one of my mates in high school told another mate I was weird because I watched a lot of foreign films on sbs
Totally their loss mate.
The ‘foreign’ films on Saturday nights on SBS were amazing.
My clearest memory is a film where a church gets bricked up with some nun’s inside. Ends up with rather attractive busty nuns running around topless going crazy. No idea what it’s called and I’m sure it was entirely inappropriate for 12 y/o me to be watching. Still awesome.
@sunsoar77
Oh yeah, he’s an idiot. I laughed when I was told.
The movie that I remember most is Black Holes where I guy dates a hooker &…
Maybe a story for another time.
But one of the bookers gets robbed & walks home naked. There’s this loooong shot of her walking toward the camera from the distance & it’s hard to make out features. You presume she has panties on but as she gets close enough you realise she has the thickest, bushiest Bush that ever did bush.
You like being stabbed in the ear. You might like being jabbed in the rear too! #HighSchoolLogic #FearTheDifferent
It rhymes, so it must be true!
Different = gay. That’s all high school logic was
Helloooooo
Is it me your looking for?
Sure, I’m easy
*wink* $500 for the first 5 minutes 300 every additional minute
I’ll take eight!
Oh, B-ob, at last you’re becoming a crafty consumer!
I can see it in you eyes!
Seeing all these articles pop up lately lambasting devs for getting publishers after kickstarters (eg: Shenmue, Red Ash) and now I get an email from Playtonic telling me Yooka Laylee will be published by Team 17.
I’m not a big fan of kickstarting to get a publisher, but as long as it’s a fully disclosed goal of the campaign I have no issues. Was the Team 17 thing a shock or were they always planning on finding someone?
Never mentioned it. They’re framing it as Team 17 handling the QA and support while they concentrate on making the game while completely missing any mention of funding from them. It would be silly to assume there wouldn’t be any but some transparency would be nice.
The thing I read about it said they were always open to finding a publisher and said that from the start.
I never followed the KS close enough to say whether that was the case or not, but *shrug*
Haven’t heard about Red Ash, but from what I understand the “problem” with ones like Shenmue and Bloodstained is they’re being funded by these outside sources already while asking people for money, so I guess it kind of feels like double-dipping? Or at the very least, being a bit disingenuous. Though with Team 17 they seem to just be handling the publishing side of things for Playtonic and aren’t actually funding the game at all.
I like the part where there’s a possibility of getting a physical release from this, so I’m happy to hear it 😛
It’s not going to be much of a game with purely the kickstarter funding it. And Team 17 won’t be doing it all for free.
I don’t think it’s a problem if they’re honest about it, see my verbal diarrhoea below
All I ever cared about was getting more of what I like. Exactly how it became a thing (outside of child labour, deforestation or clubbing baby seals) was never an issue.
So, if down the track they got a publisher & it improves the thing, then great.
I do believe they should be as upfront as possible from the beginning though.
So, if they already have a publisher, they should say so. If they can’t say who, fair enough, but still be upfront & say all that.
The two I backed, Shenmue & Bloodstained had publishers beforehand.
Bloodstained said it straight up, it was in the first video. Something along the lines of “We have a publisher if this ks is successful”.
Shenmue on the otber hand did it’s best to cover up the fact they had two publishers. Which is total bullshit. It confused matters & gives people the wrong idea of what kind of cash is needed, which in the long run is even worse for future kickstarters.
On another similar but unrelated point:
FUCK IM GLAD THEY FOUND A PUBLISHER FOR RED ASH.
Does Indiegala use USD or AUD?
https://www.indiegala.com/store/product/dying-light/239140
I will pay $30, but I feel $40 is too much. This is why i am asking.
Yes?
Just an FYI in case you can’t decide and miss out, it’s been $43 on OGS for a Steam key since release.
EDIT: Also, at a regular price of $60 on Indiegala I’d assume it’s USD.
I can’t find a definitive answer on the site. They claim on things like tax it will check your IP for which country you live in but nothing that says “prices are set to your IP”.
USD, have used them on a few occasions
I won’t be buying it then
Oh yeah you like hidden mystery games yeah? Indiegala has a hidden mystery bundle, $2.50 for 12 games, unless you already have them I suppose 😛
Yup, own all of them. Mum likes that company so I signed her up to be a Beta tester
@negativezero I managed to track down and watch the first episode of Sakura Wars. You weren’t kidding about the whole 1920s Japan thing. I love the style of it (even if the animation is quite dated now) but the thing that sold me most was the opera and theatre music. Holy crap was it good. Not sure if I want to keep watching the dub version I found but I’m definitely sold on the setting.
Animation is dated? I don’t remember it being bad. Was by hand yes?
Do you prefer the cg stuff?
I believe it was by hand but it was more the style of drawing that showed its age. It has that late 90s animation style with sharp, angular faces. It’s not bad but it is distinctly different from newer animation styles.
I don’t mind CG stuff and I don’t really have a favourite style of animation. Unless the animation quality is really terrible bordering on a slideshow, I generally don’t judge an animation too much.
Oh man, I have a nostalgic boner for that 90s angular stuff.
I seem to be traveling backwards in time with anime, I don’t like too much of the modern styles & I’m getting more & more into the 70s & 80s stuff I used to think looked lame.
Also, I find some (not all, Innocence is an example of it looking amazing) CG stuff to rely too much on the computer & take on this lifeless, flash animation look.
I can appreciate a good flash animation from someone with zero budget, but I expect a lot more from a studio.
Yeah I agree. CG stuff can be awesome but when it’s shoddy or cheaply done, it looks absolutely terrible. I imagine that it’s mostly due to unfamiliarity but still, as you say, a studio should be able to get things looking at least halfway decent in CG.
The style of it is very late 90s. Also because it’s Kousuke Fujishima’s character designs it’s got a very ‘classic’ look to it if you’ve watched a bit of 90s anime, since he also did the design work for Ah! My Goddess and You’re Under Arrest.
Ah! My Goddess has *the* best hair!
Hunter X Hunter might disagree, but the hair in AMG is certainly pretty impressive.
Hilarious
Nooo, don’t watch it dubbed. The dub was bad and the Japanese cast is awesome. Chisa Yokoyama absolutely knocks it out of the park as Sakura. Incredible presence.
And yeah, the music is rad. Has One of my favourite opening pieces ever.
Noted. I shall search for an appropriate subbed version and try and watch through it all eventually.
Got a phone call about a job application I’ve been waiting over a month to hear about. Totally got an interview.
Oh yeeeaaah, this is what NERVOUS AS SHIT feels like.
Break a leg, literally, break a leg. Every one of your competition. Who wants to hire someone with a broken leg
Break your own leg, less legal backlash plus bonus sympathy and if you don’t get the job you can call A Current Affair and say they refused you the job because of your leg and how its discrimination
Just remember:
If they ask what to do when a server crashes, the answer is to reboot it 3 times.
Backup system crashed. Data corrupt.
Updated Adobe Reader, went to lunch.
Adobe Reader? Pffft noob! *updates flash player*
Hey @rize remember that guy that worked at the same company as us, allegedly used to be a level 3 support and then asked for help on how to update Flash Player? Good times
*cries*
Oh God, all the bullshit tends to happen at lunch, amirite?
And remind them NEVER to type “Google” into Google!
Totally read that as “this is what a nervous shit feels like”.
Good luck!
With the interview I mean.
An Australia Post courier actually buzzed my apartment to drop off a package today.
This turns my worldview on its head.
THE END TIMES ARE HERE!
Dear Transient.
As a representative of Auspost I would like to apologise for this courier’s actions and can assure you that this abnormal incident will not happen again.
Crisis averted. Thank you Postmaster Nob.
My local postie is a good bloke actually, always knocks and usually makes sure to come round when I’m likely to be home.
You even have a way of making boring stories sound interesting 😛
*sings* Lion’s gay for Transient!
Who isn’t?
😛
Well, I’m not not gay for him…
Yet.
*fans self*
*takes off drenched T-shirt*
Who then?
There’s got to be someone?
No-one’s gay for moleman.
You’re missing out!
True.
#mostinterestingmanontay
*monocle drops*
They delivered a package to me (well, my Mum’s house) today after saying they weren’t going to be able to do it until Monday.
First day at work wearing my glasses today.
Half the people who I said “Good Morning” to did not acknowledged them. Which is… good? Maybe they just haven’t actually looked at my face before today.
But hey, it’s almost lunch time and my eyes aren’t spazzing out already so it’s a win regardless!
“All you nerds look the same to me”.
They think you’re someone else.
That would explain the lack of face-punching!
I’ve had a beard for over two and a half years. When I showed a render of myself to a co-worker, she said “Oh, are you going to grow a beard now?”
She hadn’t noticed my face in nearly three years.
Never underestimate just how little attention your co-workers pay to you. They might not have noticed your glasses, or they might think you’ve always had them!
You had a beard!? When?! =P
I usually only have three, maybe four shirts for work that I alternate between. sometimes I feel really self conscious about having a lot of repetition in my wardrobe.
Then I realise I couldn’t tell you how frequently my boss wears a certain shirt, or what the guy next to me was wearing yesterday, and realise I have nothing to worry about.
Mine were transition lenses & I met people in daylight. I presume they presumed I was wearing sunglasses
Whenever I pick up new glasses or get a haircut, I like to take note of reactions to see if people catch the change. One time I got on the train to go into the inner west to pick up new glasses in my lunch break, returning an hour later with drastically different frames (going from a coppery coloured wire frame to black plastic). Not a flicker of recognition.
Three coats done, and the boots are looking more kind of orange/brown than red ;_;
Ooh, new climbing place.
Baw, all the way over in Alexandria.
Egypt?
Had someone important at work ask how my team keeps managing to consistently close more calls than we’re given thus giving us much higher closes than most teams. Looks at my stats and we’re currently 35 logged to us, 47 closed. Sent him a report to show him how much stuff we do for other people on top of our own workload.
His shocked reaction would be far more gratifying if I hadn’t already been pointing this out for weeks.
Don’t you have a job interview to be prepping for =P
He doesn’t need prep.
He’s… The Closer (TM).
Yeah but I’m trying to be polite about it while at my current job 😛
“Proactive Solutions” 😛
http://gematsu.com/2015/07/final-fantasy-vii-remake-bringing-dramatic-changes-combat
I’m out. Fuck this thing.
As long as it’s not similar to XIII and variations I’m going in with an open mind. If it is, I’m still in, I’ll just be a tad more hesitant with the love.
I think it’s probably a safe assumption that we’ll end up with something similar to XV.
If it’s like XV I’m definitely out.
SO HYPE FOR FF7 LIEK FF15!
Combat has dramitically changed..you now only control cloud, and combat is decided by rock paper scissors while boss battles is a tedious death stare of who can be the first to win scrabble
Eh, not a lot of detail there.
There’s no way to write this without innuendo…
Malteasers – crunch them or suck them?
https://en.wikipedia.org/wiki/Maltese_people
I alternate between the two. I usually start out sucking gently, caressing them with my tongue, applying a little pressure, but eventually I crush them in my mouth like a ravenous animal, swallowing the thick paste-like mixture with relish.
I’m half Maltese and the correct answer is crunch.
Crunch. People who suck them obviously suck.
Start by sucking. Take your time, revel in the slow wash of sensations as you push between layers, until you can’t handle it any more and abandon yourself to devouring them with passion and hunger.
….did the site just explode and turn all broken looking for anyone else?
Ever since my work upgraded us to IE10 instead of having to use 8, this is the first time in over a year that the site hasn’t looked like utter shit.
So no, sorry.
Random elements are failing to load properly.
Captain Planet is going to be really upset.
Looks like they’re refreshing the design on us
Who whoa whoa. ‘Elsewhere on the web?’ links on Kotaku? *recoils in horror*
And bloody share link buttons taking up the bottom part of my page. I can’t even.see the rest of this comment box.
Also, mad increased loading times.
Fuck it, I’m out for today.
Well, they only just implemented it, so I’ll give them the benefit of the doubt for now. I just instinctively gag a little at ‘From around the web’ type links. Rest of the design seems nice so far.
I leave for 5 minutes and the whole website design changes!
I like it though.
It’s all your fault Pow! You never should have left us! D’:
Looks nice in an article, but in TAY it’s weird having both button rows on one page.
Oh, wow. I just thought the background shading wasn’t loading for some reason, but the front page auto-loads the next page as you scroll… nifty. That said, the “Trending Stories” thing is a bit large, and seems superfluous given the ever-present “most viewed” and “most commented” sections on the right…
Not to mention the ‘around our network’ stuff that drops in below it.
It changed im on my phone and hadn’t noticed
Guys, Kotaku is changing again.
I’m scared D:
I say again even though it’s been, what, 3 or 4 years?
Still feels like yesterday…
Ah… Remember when they gave us accounts we could actually log in to? Those were the days…
Even if it did mean the death of Yellowius and and range of other accounts
Never forget Jeeves
There are ways around it, for the dedicated.
I still think we should gone with the chuloopa nipples for user ratings idea.
Either my fever’s gotten worse than I thought or the whole world just changed.
/bandwagon
There is no spoon.
WAH. This comment appeared without me refreshing the page. What sorcery is *faints*
Bashing my F5 button on a slow TAY day is an age old past time! What…. will I do with my F5 key now?
What is real?
Who am I?
You’re a wizard, ‘nef!
https://youtu.be/0svypHu7-oo
Notifications sticking the top of the screen while scrolling.
FRACKING FINALLY! Thanks Kotaku team! 😀
Meanwhile I’ve always hated floating bars that follow the screen as you scroll like that. Make it go away 😛
You humans are never happy, sheesh!
Maybe if you machines would stop trying to take over we would be!
Don’t try to pin this on us, meatbag 😛
No, just @mrtaco. He is a tech-hipster/luddite.
Ooh, snazzy.
Did the page just auto-update?
I’m scared.
I do wonder if, after a site update, the staff just head in to TAY and watch us all panic.
@serrels sits back in his high leather chair, fingers steepled. Yesssss…. yes. See them squirm.
You know they do. You would the same thing
Indeed we do 😉
Im onto you Hussey, you and your sick game of changing things on us without notice
Half of Kotaku is now in tay…
Nice try, Kotaku, but I ain’t leaving TAY! *refresh*
KoTAYku is its new name as we have merged into one sentient being
Not a fan of the elsewhere on the web stuff, but otherwise spiffy redesign! Love the infinite scroll on the main page and floating bar at top too!
So, haven’t seen the main site yet but the new mobile site is godawful. Hard to read properly and now with 10mb of extra data per page refresh (according to my data tracker), I probably won’t be around much any more. Literally can’t afford it financially.
Seriously Kotaku, mobile sites shouldn’t be so data heavy, especially with Australian data prices.
Is this with images disabled? If you have Chrome installed as well as the default browser, you could always disable images for one of them.
Try a mobile browser that allows you to turn off ads/images for certain websites. Helps a lot with my data cap!
Hopefully teething issues. Either way, you should report it when you have a chance.
New mobile?
Still looks pretty much the same to me except for two sets of social media links top and bottom of the ‘story’ (or pretty much just an image for TAY)
Sounds like I’ve missed out on something bad though, so that’s a-ok for me.
I’m also getting a tonne of Kotaku, Gizmodo and Life hacker links and a while bunch of Around The Web links, all with their own images and scripts.
Ah, that’s probably the ominous ‘Loading page’ thing that never resolves for me on the front page.
I’m not seeing the ‘around the web’ stuff on PC but adblock must be intercepting them. And that won’t be changing because ‘around the web’ related link things are the fucking devil’s work.
Can you provide the url of the page that this occurred on?
Typically, after scrolling through the new main article list, 5 additional article list pages will be loaded – from testing, the typical total weight of all 5 of these pages is 2-3mb or around 500-750kb per page.
As for within articles, where we can, we’ve now implemented ‘Play’ buttons for GIF images on mobile.
Whilst we haven’t been able to do this for all GIFs, the majority of articles will not download the GIF image until ‘play’ is clicked – helping to keep your mobile data plan sensible.
Can we have an option for that on the desktop site too please? There’s nothing more annoying than trying to read the content of a page and having some animation jumping up and down in your peripheral vision like a jack russell puppy that’s just been told it’s time for walkies. The eye’s drawn to movement and it’s incredibly distracting.
Not to mention the US team’s predilection for making massive long GIFs and then the content of the article being a link to a youtube video they made the GIF from.
In non-site update news, I woke up this morning to a message on reddit from someone asking me to be a contributor for Sidelines.
It looks like a very, very casual (read: unpaid) writing gig where they get people to blog about things and pretend that they’re doing real writing.
That may not be the best description of the site. It’s hard to get a real handle around exactly what they do. I do know that if you get good at being a contributor, you get memberships for Netflix, Hulu and even Steam! Coveted Steam memberships!
AUGH. I just went to check out the mobile version of the site on my phone to see if there were any changes. Still had the same problem of before, where the drop-down menu with all the categories is permanently dropped-down. Except while it used to be ok since in portrait mode there was a thin strip at the bottom of the screen where I could still reach the “back” page, now whenever I get to the bottom to try and hit the Switch To Desktop button it just loads the next page as an infini-scroll thing so I can never actually reach the bottom. And then if I try and do it in an article instead where there’ll be no continual loading of new stuff (once the trending topics finish doing their thing at least), I can’t do anything anyway because that free strip is covered by all the share buttons.
Curse everything.
Oh, it’s not just limited to the mobile front page. Can’t actually reach the bottom of the page on here either. Why is that supposed to be a good idea?
Hey MrTaco.
We’ve now implemented a capped auto-pagination feature – meaning that when scrolling through the main list of articles, up to five pages will load when you get to the bottom of the page. This means you no longer have to keep clicking ‘Next’.
Regarding your mobile issue – can you post a link to a screenshot of the issue, then provide us with the phone model and browser version that you are using – we’ll look into it.
It’s a Nokia 808, and happens on Opera Mobile. I know it’s an old phone and won’t be supported and I’m not expecting it to be, was just testing to see whether I’d be able to use it or not and thought I’d gotten stuck. Most of the time I use Opera Mini anyway, which does the whole website compression thing and that happens to strip out most of the annoying javascript type stuff anyway, so the mobile site works there for me. Though it’s occasionally a bit buggy and doesn’t do comments and stuff properly, so sometimes there’s a need to switch to Mobile.
I took a bunch of screenies from both browsers, and labelled them all anyway though.
http://imgur.com/a/leKpp
They literally only just implemented it. Give them a little bit of time. =)
After 10 pages of auto-loading it seemed to stop. So I managed to escape.
Never!
Not overly a fan of the elsewhere on the web ads but meh I’ll just stick to TAY and avoid it.
Definitely not a fan of the “trending stories right now” at the very bottom though, I used to just check out articles from the black section at the bottom of the site across Giz/LH and Kotaku; kind of annoying having to scroll almost 2 pages worth of pictures just to get to that black banner now =[
Edit: especially when there’s gif’s as pictures for the articles; it’s kind of making me not want to look anywhere else in the site while I’m browsing at work.
I can come to terms with most advertising, but Elsewhere on the Web is never good. I know the bills must be paid but it’s just clickbait paying to stand close enough to real content that users might accidentally confuse it with something they want to see.
‘Trending Stories Right Now’ area is longer than TAY :\
Kind of jarring to scroll to the bottom of a page and then suddenly have a bunch of redundant content drop in and suddenly I’m only 3/4 the way through the page.
@robhussey as a thought, maybe that area could have the first one in the list big, and then the rest half-sized, like in the ‘across our network’ area below it? Incidentally those two areas feel like they’re doubling up the same content.
As it is right now, it feels like the front page has been dumped below the comments of every article.
This! We already have the black banner at the bottom of the page to update for new content; the list of trending articles seems redundant.
Yeah, I’d almost rather see that area expanded to top 5 trending or something.
Welp, Bungie’s started talking about the Dreadnought and a new strike coming in Taken King… time to find a cave on Mars, shut my eyes and put my fingers in my ears. And await the inevitable punch in the face from a guardian annoyed with me for blocking a spawn…
Seriously… “We want you to discover these amazing things we’ve added to patrol! Here are a few examples: …” *sigh*
I got the dirt.
How to garden?
Get the puppy to dig some holes and then fill the holes with plants.
So, the Ace Attorney movie… absolutely batshit crazy… in both good and not-as-good ways. I honestly can’t decide if I enjoyed it or not.
You enjoyed it. Case closed.
*Bangs gavel. Gumshoe throws confetti everywhere*
I think this is probably the correct conclusion.
BUT WHERE IS YOUR EVIDENCE!
Must say, I was shocked when Von Karma started swearing! Swearing in my Ace Attorney… unprecedented!Ahem, when the confetti is thrown, the trial is over. It’s like you don’t even know how a court of law works.
Gold.
I didn’t like it 😛 Didn’t want to sway your opinion on it before watching though.
PSA from someone who works in IT support:
If you don’t like a new feature, absolutely complain about it…but give constructive criticism.
“[change] is shit!” isn’t helpful but “[change] is making it harder to do [whatever]” can lead to a better experience for everyone.
I don’t know. Complaining is really fun.
You’re shit.
See? Fun!
Eh, the two main complaints have been about the mobile site and they appear to be helpful.
Not directing it at anyone or any comment. Just making sure everyone remembers there’s people behind the changes, and to be helpful and polite 🙂
Played a Chemistry game against Anton last night.
He was quite upset when I won 😀
See! Getting your head cracked open has benefits!
For the record, this was the game,
https://boardgamegeek.com/boardgame/118174/compounded
Yay for Kickstarter games!
Hi @robhussey
I’m an IT know nothing, how do the notification links work?
If I get 5 notifications for one page & follow the link, the highlights disappear on the other 4.
Is there a way you can make this not happen at all?
Sometimes it hard to keep track of which I have & haven’t read. Especially when it’s 5 notifications from the same @liondrive
The instant you visit the page, it clears the unread notifications for all the pages. Always worked that way. It’s possible to avoid this (move it to a JS process which sends a message back to the site when you scroll over an unread comment) but it would probably require re-coding the site, would probably not play well with mobile at all.
I’m 90% sure that it only clears the notification for comments on the page you’re viewing. I’ve definitely had multiple notifications across multiple pages before and not had them all clear.
Yeah, while not what I typed that’s what I meant. Not all the pages, but all the notifications on the page.
Ah cool, cheers
Apparently new Kotaku doesn’t want me. Refreshed the page and got a”Success! You have been logged out.” message. Except I’m not logged out. Magic. 😛
Witchcraft!
I was getting that a lot a few months back, only it thought I was logged in, I’d type a message & then I’d be logged out.
Miraculously stopped.
How strange.
Hmm… I guess I didn’t get a notification of @negativezero’s reply because I leave this tab open, so it loaded the comment automatically, even if it did so waaaay at the top of the page and off-screen at the time? That’s a little counterintuitive, when comment pages (esp. in TAY) can get so long.
I jump back on the active TAY page all the time, due to my very busy workload. You just need to learn to procrastinate more 😛
True never realized the side-effect of auto-updating the page. It means everytime it updates the notifications will get marked off as read even if they were for comments made much earlier. Might need to implement a system where people can mark off replies as “read” or modify the coding so that the notifications only trigger as read once a person has scrolled past the reply.
Yeah, @robhussey this is going to be a problem. I usually have a TAY tab open on the most recent page both at home and at work and if it’s going to auto-clear my notifications I’m never going to see people replying to me. Not sure if there’s anything you can do with that though, it might require a re-think of the way the notifications are cleared.
Agreed, that’s not an ideal outcome to the refresh feature.
We’ll note it down and have a think.
Ahhh that new TAY smell!
But it’s not Monday…
Smells good though.
Life is Strange Ep. 4
@shane, @dc et al.
(I typed this up two nights back then refreshed the page before I posted it and cried myself to sleep)
HAHAHA! Now I feel justified in blaming Mr. Jefferson for what happened, even though I did it because it would have the least harmful to me response, not because I suspected him even though he’s clearly a villain (“Seriously though, I could frame any one of you in a dark corner, and capture you in a moment of desperation.” (taking quotes out of context is fun))!Also, I feel really bad about the bird, that has been dead since episode one for me, and my poor plant, who I killed with love.
In terms of choices, I went for youth in Asia, left whatsisname the drug dealer with a knife in his leg (I figured there’d be a better ending, but ehhh), Victoria trusted my warning (we had a moment), let Warren beat the crap out of Nathan, and I assume there’s something else I forgot.
The Warren situation is a little awkward right now, I’ve always tried to just be a friend to him, but I agreed to Ape it up, and now I feel bad for Brooke, even though she’s always been a bit icy to me and I sort of wish I could take it back because I NEVER MEANT FOR THIS AND WE’RE JUST FRIENDS. This is like High School all over agai- oh.
I blamed David and got him suspended and he’s probably the only innocent person in this whole mess at the moment. Oh man! Haha! That bird keeps coming back to haunt me as well. D:I feel sort of bad for David. He isn’t a nice person, and I’m not sure I’d even call him a good person, but he is trying to help, in his own way, and he’s basically ended up in the Snape position here. Won’t stop me from shutting him down when he’s being a jerk though.I feel like his relationship with Joyce is a redeeming feature too. I always go easy on him, just because that family has suffered enough!Upvoting for support, I can’t read the spoiler :'(
I keep getting confused on the front page with the Share thing no longer on the articles. My eyes keep looking for the second lot of pink numbers and wondering why nobody’s commented on anything 😛
CHANGE IS INHERENTLY BAD. Our generation knows this. *nods sagely*
Change is inevitable, old man. Please don’t hurt me. ;P
I’m still hanging out to see this auto update comment feature. Does it work with Chrome? Must I disable adblock? Will it happen if I briefly look away? What if I pretend to look away, press F5.. aha!
BOOM.
I haven’t seen it either, though. Also Chrome.
Jinx! Comment buddies! lookit that; same time-stamp and everything.
Edit: We would totally rock it at the Peek-A-Boo World championships.
Yeah, I had to refresh to see your comment and I’ve paused adblock. Must be Chrome.
Watch closely…. are you watching? closely?……………. BAZINGA!
Love The Prestige reference.
That’s where it’s from! I knew it sounded familiar in my head xD
The refresh that everyone is referring to happens X minutes after you haven’t interacted with the page.
Basically it means that if you leave the tab inactive, as soon as you re-interact with the page, it is reloaded to make sure you get the latest content updates.
That’s nifty for Tay.
40 mins of work to go and…. ????
Page get, oh lame
I think pages are getting smaller so easier to read while simultaneously bring TAY back into the meaty page get machine it was in the olden days
Still 25 root posts on the last page, so same as ever, there was just a lot of discussion about the new look.
So the mobile site hs changed now too, I’d love to get a professional internship experience and enjoy Tel Aviv
Ah, Tel Aviv! Just the name alone conjures images of tranquil beauty and no strife to be found! 😛
No Strife? In Israel?
ummmmm
That’s the joke.
http://i.ytimg.com/vi/joO1zz3kHTk/hqdefault.jpg
Once my old man spoke to good King Triton,
And asked: “Why all this senseless fightin’?”,
“Why can’t us men express emotion?”,
Now I’ve got a friend in the ocean.
He wouldn’t happen to… LIVE IN A PINEAPPLE UNDER THE SEA?
SPONGEBOB SQUAREPANTS!
ABSORBENT AND YELLOW AND POROUS IS HE?
SPONGEBOB SQUAREPANTS!
@pixel_the_ferret_viking Just got a reminder that I can pick up a growler of this this afternoon: http://www.thirstycrow.com.au/catalog/vanilla-milk-stout/
Growler’s are awesome… I love the incentive to drink nearly 2L of beer alone. 🙂
*drools*
Still preferred the chocolate milk stout though 😛
*Pointed cough*
Mass Effect 3 update:
Turns out I couldn’t save Mordin in any of my scenarios as I went back and attempted it a total of four times. It may have something to do with Eve dying in all the situations and/or me not importing any previous Mass Effect game saves/data. No biggie, now I can get on with the rest of the game. 😀Perthites, my Brother is performing tonight at Lazy Susan’s (Brisbane Hotel, Highgate apparently) at 8pm if you want to see what I go on about here each march.
Why’s he gotta perform at the Brisbane Hotel in Perth? Can’t he perform at the Perth Hotel in Brisbane?
I’m not his booking agent! complain to him! He’s @angus_hodge on twitter!
@angus_hodge – Your brother says you need to get a better booking agent. Perth Hotel in Brisbane not Brisbane Hotel in Perth. D’oh!
Let me tag that for you:
@fled @grandmasterb-funk @hindenlagen @liondrive @phlanispo @phoenix @platinum-urchin @thecracks
Might want to give a bit more notice next time 😛
He didn’t plug his gigs on fb real well.
For all those thinking of subbing to SWTOR. If you sub by the 31st (in America) you will get a bonus companion.
That’s real interesting… but, I uh…
…may have…
…recently grabbed expansion and resub’d to ff14…
…maybe >_>
Weird so the laptop I bought yesterday (MSI GS60-2QE, Broadwell CPU) still doesn’t have Win10 drivers, but the 17″ version (GS70-2QE, Broadwell CPU) does. As far as I can tell these things are basically the same computer and the only diff is the 17″ has a third mSATA slot for SSD, extra mini-DP and a line-in jack.
When I get home I’m going to try installing the drivers from the bigger one.
I was up until like 5am this morning troubleshooting the Win10 upgrade. Their site is all YEAH READY FOR WIN10 but they really aren’t. 🙁 Probably will be in a week or two. Biggest issue was that I was getting wierd internet connectivity. Could browse fine, but windows update shat itself, I couldn’t swap over to my microsoft account and had to use a local one, and stuff just didn’t seem quite right. Turns out the wireless was half-buggered and needed new drivers which the manufacturer has had available for a while now (but MSI haven’t uploaded even for the GS70 yet. :\) but then trying to download the driver would stall out everything. I assumed their site was on the fritz. Wasn’t until I tried downloading it on my old laptop that I realized it was actually the driver shitting the bed.
I read somewhere this morning that to perform a clean installation you end up installing Windows 10 twice. Uh..
That’s if you do it wrong. One way to do it is to upgrade to 10, then use the feature that does a wipe & reinstall, but you can skip that.
Use this tool: https://www.microsoft.com/en-us/software-download/windows10
Which is able to do two things:
– Create a bootable Win10 upgrade/install USB or DVD (or ISO if you’re that way inclined)
– Upgrade the current machine to Win10.
When you choose the second option it’ll download everything and start installing, and when it’s ready to go it will prompt you whether you want to keep existing settings, files, folders etc. or nuke & pave.
Going out to dinner with Dare Girl tonight.
I think technically this is the third date?
*grabs popcorn*
*cough* third date *cough*
*sets up popcorn cart*
GET YER POPPED CORN! POPCORN, RIGHT ‘ERE
If I was rude I would make a joke about cutting a hole in the bottom of the popcorn cup. Thank goodness I’m not that rude though
You’re the type of gentleman that puts it in her hand openly, brazenly and unapologetically?
True story that happened to a friend of mines sister:
Dude pulled his junk out and when she asked what the fuck he was doing he responded with “I thought you might want to hold it.”
How thoughtful.
*takes note*
I have had this happen to me too. I don’t think it is a successful seduction technique, but it may vary.
Dare Girl?
Fourth paragraph. Retconned the name there though because I dum’d when I tried to think of one 😛
So after screwing around with ad blockers, image blockers, social blockers and a bunch of other add ons the mobile experience is still horrendous. Too cluttered with poor usability and not very readable, keeps loading stuff and the page keeps jumping around and even with everything blocked still uses a ton more data albeit less than without the blockers. Very disappointing since mobile was my primary way of accessing Tay.
In middle of typing this out the page has jumped to random parts of the page 3 times. Use the bottom shortcut to get back and start typing again and it’s starts loading even more. A frustrating, horrible experience. Nigh unusable.
That said tried accessing the main site from the work laptop (please ignore it Miss IT manager lady) and I don’t mind it. Nice and clean and the ads don’t stick out obnoxiously.
All I’ve got is the social sites bar across the bottom. Otherwise, exactly the same.
Chrome in a HTC
Oh wait, no. There’s shit at the bottom. But I didn’t notice til I went out of my way to check
Tag @robhussey and maybe make some suggestions on how to make it easier to use?
I have same as @jimu – seems to be very little change.
Unless your requesting desktop version down to your phone?
Although TAY has always been hideously unresponsive in Chrome on my phone whilst it loads all the posts then stalls and stutters when writing posts. Not sure if just my phone or poor mobile optimisation for comment heavy threads on Kotaku.
My phone has always handled Tay no problem, it still is on the performance side of things, it just doesn’t seem to know what to do with everything popping in.
Opera on a Xperia Z3 here which I’ll admit is probably a rare combination to cater to.
I think it might be an HTC / Sense UI thing because I’ve tried with Opera and Firefox browsers and get same laggy garbage experience.
Do you have the ‘compression’ thing turned on in Opera? Might be causing weirdness?
I had to stop using opera because it just didn’t like TAY. I still use it for everything else though
After the tragedy of losing the character I spent ages making last night, I finally got the willpower to try Dragon Age Origins again and attempt to re-create the character. But she’s not the same!
Introducing Almira, the female city elf warrior. I named her after the second result I saw on behindthename.com. I customised her so she looks permanently sad because of all the elf oppression. Then I gave her orange hair for maximum societal oppression. I’m going to be disadvantaged as shit.
It’s annoying that TES Skyrim was the first proper RPG I played outside of Pokemon. I got used to some luxuries of world-building. The most prominent thing being NPCs. I’m used to every NPC being named, having a unique appearance and some sort of a character. So I get weirded out when I’m surrounded by identical-looking NPCs without names all saying the same thing.
pfft, Dragon Age tells a story much, much better than Skyrim. Its characters have, y’know, character.
Also,
Enchantments?
Enchantment!
The world in Skyrim is better than Dragon Age, but everything within the Dragon Age world is better than the stuff that fills up Skyrim’s world. Elder Scrolls games have always felt like really good movie sets to me. Populated with people who know their character’s backstory inside and out but can’t actually act.
But I want the random NPC talking to his friends by the item shop to have a name and a family and a house that only they go to and a job and have a dialogue tree. Damn you, Bethesda! You’ve spoiled me!
But it’s the same dialogue tree a billion times.
If you really want everyone to be super unique, play New Vegas.
Play the Witcher series and realise just how bland and empty Bethesda games really are.
Woo, parents are out for the night. Now I can sneak off undetected 😛
Party at Gooky’s place tonight?
He’s out on a date with Dare Girl.
House is empty.
*pop*
That was my cherry popping 🙂
Hey Sydney people… so what’s North Ryde like? Pretty kewl place?
Expensive? Cool suburbs around? How’s public transport?
Cool. Cool.
‘Salright I guess.
ihy Mr Sniper
Hiy Mr Greenman
hay!
There are buses and trains to the city, the traffic is terrible at peak times. Main attractions are Macquarie University and Macquarie Shopping centre.
The Sydney office for the company I work for is in North Ryde
Yeah, it’s a big office type hub.
The Sydney Office for Microsoft is in North Ryde…
We can chat on other social media if you have any other q’s. I used to work in North Ryde.
Ooh thanks! I’ll have many more questions if things end up happening 😛
Early days for now!
I just got insta-killed by the alien in isolation.
I was busy avoiding a droid & it popped outta the ceiling & killed me in one hit.
Is this what I’m having to deal with?
Am I going to get randomly punished for no apparent reason?
Or have a missed something? Is there something I can do to avoid this situation?
Look at the ceiling vents, if the alien is there then drool and stuff will start dripping out, and it’ll play a sound.
How can I possibly look at a ceiling vent while avoiding a droid?
I feel like I’m being punished for no reason.
By… multitasking?
That bit felt fair to me, but hey, diff’rent strokes, and all that.
I just had it pop down from a vent again, fully able to see , anticipate & it still killed me. My fault, fair death.
There’s was simply no way for me to avoid death in the other instance.
Seems I just suck at this. Fully scripted alien encounter in the hospital & I just keep dying.
Should stick to my RPGs & 2d platformers.
Keep going, or put the difficulty down (I still haven’t played in ages… Too damn scared lol)
I’m already on the lowest difficulty. It makes everything else easy, but the alien is still a super sensitive, one hit killer.
I’m slowly making progress.
I was expecting more Survival Horror & less stealth.
This was also what I was expecting too.
And the frustration is overlapping the fear unfortunately 🙁
Finally heading home tomorrow.
Going from 24-25C to 11-12C.
O_O
@robhussey Since everyone is bugging you anyway I might as well bring it up now, have you guys considered a button up top of the comments section that lets a user filter them down to only showing comment chains they’ve either started, responded in or been tagged in? Cracked has a feature like that which is a lot more handy there since the volume of comments is overwhelming, but it’d come in handy here too when things get busy or comments are spread over multiple pages.
Woo, August! \o/
Hahaha, got to the end of Dare Girl’s driveway just as her music student was pulling in. Way too close 😛
Giggity.
So Blaghman is in Brisbane next weekend! Who’s up for dinner at 7pm on Saturday 8th!. Probably The Burrow at West End? (I don’t mind where we go, I think Rockets was keen for here though!) We’ll most likely have to make reservations, so are you in? 🙂
@beardymcmuttonchops @beeawwb @cufcfan616 @dc @freezespreston @gutsoup @janexo @jimu @lambomann007 @popdart5 @sernobulus @strange @sughly @transientmind @welbot @virus__ @rocketman
Confirmed: DC, Freeze, Transient, Lambo, Strange, Nobs, Blaghman, Welbot.
@blaghman
That’s me!
I thought you were @bish
Yeah, I should be good to go.
I’m in.
Can’t make it sorry man – Grandad is coming to Brissie that night and we’re spending it with him at Mum’s place, having a BBQ 🙁
That’s okay. Some other time. 🙂
I am in!
Unless Brisbane suddenly warms up, I’m not heading out into the asthma inducing cold, sorry @blaghman
I can only barely forgive you, Jimu. 😛
D:
booourns! it’s been warm this weekend! My guess, winter’s over for another 10 years
Me, me! I’m in! 😀
Be good to catch up with you, haven’t seen you in ages.
I’m keen!
I might end up being late, or possibly very early.
I don’t know. I have to make my way up from Browns Plains.
Oh we’ll adjust to time to what’s good for you. I thought you said 7 last time we talked about it, but doesn’t have to be that. 🙂
I’ll be at my Grandmother’s birthday thing that afternoon, but I have no idea when it will end, so I think it’s easier if we just say seven and be ready for me to be terribly wrong.
At this stage, I believe I am ok to attend!
Aww, probably a big maybe for me this weekend – Ash’s mum will be away so chances are I cant 🙁
Aw, that’s too bad, but understandable!
hello Fronds! Anyone up for Crotas End, Destiny PS4? need one more to complete party! first timers, very loud and aggressive!
So I’m casually checking my emails, and Netflix have sent me an email with the episode I’m up to for Bojack horseman titled ‘Netflix tonight?’ Goddamnit they aren’t happy with me for not bingeing and watching an entire series in a day, aren’t they?
They’re never happy =P
Wet Hot American Summer. SO GOOD.
I get the feeling that most people have absolutely no idea what’s going on in it but I think it’s going to end up sitting above Childrens Hospital for me as my favourite show (mostly because it’s basically the same people and just as insane).
As soon as I logged into Netflix it was recommending it to me last night, I should give it a look in!
It’s so, so good. Amy Poehler’s speech in episode five made me laugh for ten minutes. Literally ten minutes. Had to pause and everything.
https://twitter.com/hermitdc/status/627703566610771968
I watched the movie, and started the TV show today, and I am finding the theatre stuff way too true.
N’aww, Max is snuggling on my bed.
:3
Sid is really fluffy. He had a bath on friday
Boss thinks he is a cat and is trying to perch on the windowsill.
Kinda too big for that tho 😛
Have you seen the video of the cat that barks like a dog?
Haha. Totally trying to get the dog in trouble.
Bark! Bark! Ba-…er…meow… (Oh crap, owner caught me out)
Well that escalated quickly.
Turned down a quest in PoE and they attacked me. Had to murder the entire faction on my way out of the house.
Decent loot though.
Bronwyn Bishop is gone!
\o/
See y’all fools in new TAY 😛
Bestest page get that will go unappreciated :'(
*appreciates*
*unappreciates*
*appreciates*
Posting this on old TAY cause it’s always weird having meat logistic stuff on page one of new TAY!
So Blaghman is in Brisbane next weekend! Who’s up for dinner at 7pm on Saturday 8th!.
Tentative details: Probably The Burrow at West End? (I don’t mind where we go, I think Rockets was keen for here though!) We’ll most likely have to make reservations, so are you in? 🙂
Will give you definitive details before the weekend, pals.
@beardymcmuttonchops @beeawwb @cufcfan616 @dc @freezespreston @gutsoup @janexo @jimu @lambomann007 @popdart5 @sernobulus @strange @sughly @transientmind @welbot @virus__ @rocketman
Confirmed: DC, Freeze, Transient, Lambo, Strange, Nobs, @Blaghman, Welbot.
Edit: Forgot to remove people who already said they can’t come. Sorry ’bout that, buds.
Yes…
Tag all the fools…
Yessssssss >:)
He forgot you though.
Honey, you’re a big enough fool for the both of us :*
Soft maybe from me. I’ll be going to the footy (Q-Clash 2, Electric Boogaloo) which is at 4:30 so probably won’t get out until after 7:30, and then would have to fight my way through crowds from the Gabba to get to West End. Knowing me it’d probably be faster to walk there.
Strong chance folks will go drinking after and we can always push the time back if it’s convenient to people. Reservation hasn’t been made yet. 🙂 But yeah, sometimes it’s best not to overplan your weekend if you have something like that going on, so soft maybe is probably smart answer. 😀
Maybe, most likely not. I have birthday stuff on this weekend already and I’m not sure what shape my gf will be in after surgery. When’s the latest you need to now by?
Still no.
But it’s not coooooooooold, Jimu! 🙁
That’s what people keep telling me when I come to work in 4 layers & a beanie.
But my lung pain says otherwise.
It doesn’t have to be icy cold. Just cold.
Party pooper Jimu! :p
@beardymcmuttonchops @beeawwb @cufcfan616 @dc @freezespreston @gutsoup @janexo @jimu @lambomann007 @popdart5 @sernobulus @strange @sughly @transientmind @welbot @virus__ @rocketman
Hey guys! Just a reminder we need numbers to make reservations! If you’re keen, let us know!
Also I’m attempting to psych myself up about the reservation thing. Don’t like calling people. It’s horrible and makes me anxious and has been stressing me out for days. XD Tempted to change to a place that let’s me do reservations online. Haha!
http://theburrowwestend.com.au/
There’s a menu here if you want to know what the foods like.
Don’t change it! Just get someone else to make the resrvation phonecall. Maybe Rockets? Didn’t he have some kind of connection with the place? I’d offer but I can barely talk at the moment.
I can make a reservations call. I’ve spent years talking to strangers on the phone for a living.
Oh man, that would be amazing. You are the best! THE BEST! I’ve tweeted Rockets to see if he’s in, but if no one else seems to be keen we’ll probably have nine confirmed. Ten might be a good number? STAY TUNED! (Thanks again, bud. Appreciate it!)
Sure. Just reply again or SMS me, I’ll get ‘er locked in.
<3 <3 <3
Rockets is in. I repeat, Rockets is in. *flails arms*
So, you want me to make a booking for ten people at The Burrow for 7pm on Saturday the 8th?
You know it! Thanks bud! (Later is probably better than earlier if they can’t fit us in then, due to people travelling and etc.)
I’ll have to be a no, I’m broke.
I’ve spent the last 6 months in super hermit mode, about 4 months of which I only left the house to get food or games and walk my dog.
Thanks for the invite though.